Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A TAU CLASS GLUTATHIONE TRANSFERASE 10 FROM GLYCINE MAX
 
Authors :  K. Skopelitou, A. W. Muleta, A. C. Papageorgiou, O. Pavli, E. Flemetaki E. Chronopoulou, G. N. Skaracis, N. E. Labrou
Date :  04 Dec 13  (Deposition) - 17 Dec 14  (Release) - 01 Mar 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transferase, Biotic And Abiotic Stress, Herbicide Detoxification (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Skopelitou, A. W. Muleta, A. C. Papageorgiou, E. Chronopoulou, N. E. Labrou
Catalytic Features And Crystal Structure Of A Tau Class Glutathione Transferase From Glycine Max Specifically Upregulated In Response To Soybean Mosaic Virus Infections.
Biochim. Biophys. Acta V. 1854 166 2015
PubMed-ID: 25479053  |  Reference-DOI: 10.1016/J.BBAPAP.2014.11.008

(-) Compounds

Molecule 1 - GLUTATHIONE S-TRANSFERASE
    Chains: A, B
    EC Number: 2.5.1.18
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Organism Common: SOYBEAN
    Organism Scientific: GLYCINE MAX
    Organism Taxid: 3847
    Synonym: TAU CLASS GLUTATHIONE TRANSFERASE 10

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric/Biological Unit (2, 3)
No.NameCountTypeFull Name
1ACN1Ligand/IonACETONE
2GS82Ligand/IonS-HYDROXY-GLUTATHIONE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE A:15 , LEU A:37 , LYS A:40 , LYS A:53 , ILE A:54 , PRO A:55 , GLU A:66 , SER A:67 , HOH A:2113 , HOH A:2153 , HOH A:2157 , HOH A:2178 , HOH A:2238 , HOH A:2244 , HOH A:2365 , HOH A:2366BINDING SITE FOR RESIDUE GS8 A 1217
2AC2SOFTWAREPHE B:15 , LEU B:37 , LYS B:40 , LYS B:53 , ILE B:54 , PRO B:55 , GLU B:66 , SER B:67 , HOH B:2016 , HOH B:2029 , HOH B:2136 , HOH B:2138 , HOH B:2139 , HOH B:2212 , HOH B:2392 , HOH B:2395BINDING SITE FOR RESIDUE GS8 B 1219
3AC3SOFTWARELYS B:126 , ILE B:129 , GLU B:178 , HOH B:2180 , HOH B:2246 , HOH B:2251 , HOH B:2252BINDING SITE FOR RESIDUE ACN B 1220

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4CHS)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ile A:54 -Pro A:55
2Ile B:54 -Pro B:55

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4CHS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4CHS)

(-) Exons   (0, 0)

(no "Exon" information available for 4CHS)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee...hhhhhhhhhhhhhhh...eeee......hhhhhhhh.......eeee..eeeehhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhh...hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4chs A   2 TDEVVLLDFWPSPFGMRVRIALAEKGIEYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGKPISESLIAVQYIEEVWNDRNPLLPSDPYQRAQARFWADYVDIKIHDLGKKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNIGFVDIALVPFYTWFKVYETFGSLNIENECPRFVAWAKRCLQKESVAKSLPDQHKVYEFVVEIRKKLV 217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211      


Chain B from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhh...eeee......hhhhhhhh.......eeee..eeeehhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhh...hhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4chs B   4 EVVLLDFWPSPFGMRVRIALAEKGIEYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGKPISESLIAVQYIEEVWNDRNPLLPSDPYQRAQARFWADYVDIKIHDLGKKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNIGFVDIALVPFYTWFKVYETFGSLNIENECPRFVAWAKRCLQKESVAKSLPDQHKVYEFVVEIRKKLVIE 219
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4CHS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4CHS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4CHS)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GS8  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ile A:54 - Pro A:55   [ RasMol ]  
    Ile B:54 - Pro B:55   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4chs
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9FQE8_SOYBN | Q9FQE8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.18
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9FQE8_SOYBN | Q9FQE8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4CHS)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4CHS)