|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 4CHD) |
Sites (0, 0)| (no "Site" information available for 4CHD) |
SS Bonds (0, 0)| (no "SS Bond" information available for 4CHD) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 4CHD) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 4CHD) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 4CHD) |
Exons (0, 0)| (no "Exon" information available for 4CHD) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:135 aligned with PB2_THOGV | Q9YNA4 from UniProtKB/Swiss-Prot Length:769 Alignment length:135 556 566 576 586 596 606 616 626 636 646 656 666 676 PB2_THOGV 547 DPFSRAKSLLKSTILHAERCKEFVGNMLEEYQDPAETTVQSLVPINTWGKSAKRKLQEEITSDPDWHQCPRKRAKMSYLAIIAGSIQDRDKKQTNVPRAFMLRGSQIEYDMKATRGLVVDTTNRIIVGGETVLRE 681 SCOP domains --------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript 4chd A 547 DPFSRAKSLLKSTILHAERCKEFVGNMLEEYQDPAETTVQSLVPINTWGKSAKRKLQEEITSDPDWHQCPRKRAKMSYLAIIAGSIQDRDKKQTNVPRAFMLRGSQIEYDMKATRGLVVDTTNRIIVGGETVLRE 681 556 566 576 586 596 606 616 626 636 646 656 666 676
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 4CHD) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 4CHD) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 4CHD) |
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (PB2_THOGV | Q9YNA4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|