Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  PKA-S6K1 CHIMERA WITH COMPOUND 21E (CCT239066) BOUND
 
Authors :  S. Couty, I. M. Westwood, A. Kalusa, C. Cano, J. Travers, K. Boxall, C. L. S. Burns, J. Schmitt, L. Pickard, C. Barillari, P. C. Mcandrew, P. A. Cl S. Linardopoulos, R. J. Griffin, G. W. Aherne, F. I. Raynaud, P. Workma K. Jones, R. L. M. Van Montfort
Date :  21 Aug 13  (Deposition) - 09 Oct 13  (Release) - 20 Nov 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.58
Chains :  Asym./Biol. Unit :  A,I
Keywords :  Transferase-Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Couty, I. M. Westwood, A. Kalusa, C. Cano, J. Travers, K. Boxall, C. L. Chow, S. Burns, J. Schmitt, L. Pickard, C. Barillari, P. C. Mcandrew, P. A. Clarke, S. Linardopoulos, R. J. Griffin, G. W. Aherne, F. I. Raynaud, P. Workman, K. Jones, R. L. M. Van Montfort
The Discovery Of Potent Ribosomal S6 Kinase Inhibitors By High-Throughput Screening And Structure-Guided Drug Design.
Oncotarget V. 4 1647 2013
PubMed-ID: 24072592

(-) Compounds

Molecule 1 - CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
    ChainsA
    EC Number2.7.11.11
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    MutationYES
    Organism CommonBOVINE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    Other DetailsPKA-S6K1 CHIMERA
    SynonymPKA C-ALPHA
 
Molecule 2 - CAMP-DEPENDENT PROTEIN KINASE INHIBITOR PEPTIDE
    ChainsI
    FragmentRESIDUES 5-24
    Organism CommonBOVINE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    SyntheticYES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AI

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 7)

Asymmetric/Biological Unit (4, 7)
No.NameCountTypeFull Name
1MOH3Ligand/IonMETHANOL
2SEP2Mod. Amino AcidPHOSPHOSERINE
3TPO1Mod. Amino AcidPHOSPHOTHREONINE
4VUP1Ligand/Ion4-(1-ETHYL-6-METHYL-IMIDAZO[4,5-C]PYRIDIN-2-YL)-1,2,5-OXADIAZOL-3-AMINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:54 , VAL A:57 , ALA A:70 , LYS A:72 , LEU A:120 , GLU A:121 , TYR A:122 , LEU A:123 , GLU A:127 , MET A:173 , THR A:183 , ASP A:184 , PHE A:327BINDING SITE FOR RESIDUE VUP A1351

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4C38)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4C38)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4C38)

(-) PROSITE Motifs  (3, 3)

Asymmetric/Biological Unit (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.KAPCA_BOVIN50-73  1A:49-72
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.KAPCA_BOVIN163-175  1A:162-174
3AGC_KINASE_CTERPS51285 AGC-kinase C-terminal domain profile.KAPCA_BOVIN299-351  1A:298-350

(-) Exons   (11, 11)

Asymmetric/Biological Unit (11, 11)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSBTAT000000087271ENSBTAE00000070584chr7:9765104-976515047KAPCA_BOVIN1-16161A:14-152
1.2ENSBTAT000000087272ENSBTAE00000389552chr7:9773081-977314262KAPCA_BOVIN16-36211A:15-3521
1.3ENSBTAT000000087273ENSBTAE00000070589chr7:9773591-9773719129KAPCA_BOVIN37-79431A:36-7843
1.4ENSBTAT000000087274ENSBTAE00000070592chr7:9775980-977607899KAPCA_BOVIN80-112331A:79-11133
1.5ENSBTAT000000087275ENSBTAE00000425416chr7:9777080-977716283KAPCA_BOVIN113-140281A:112-13928
1.6ENSBTAT000000087276ENSBTAE00000070601chr7:9778181-9778307127KAPCA_BOVIN140-182431A:139-18143
1.7ENSBTAT000000087277ENSBTAE00000070605chr7:9778400-977849596KAPCA_BOVIN183-214321A:182-21332
1.8ENSBTAT000000087278ENSBTAE00000070609chr7:9778596-9778718123KAPCA_BOVIN215-255411A:214-25441
1.9ENSBTAT000000087279ENSBTAE00000427228chr7:9780756-9780920165KAPCA_BOVIN256-310551A:255-30955
1.10ENSBTAT0000000872710ENSBTAE00000383679chr7:9781489-9781832344KAPCA_BOVIN311-351411A:310-35041

2.1ENSBTAT000000107111ENSBTAE00000346604chr14:38758241-38758369129IPKA_BOVIN-00--
2.2ENSBTAT000000107112ENSBTAE00000346602chr14:38817279-38817406128IPKA_BOVIN-00--
2.3ENSBTAT000000107113ENSBTAE00000087091chr14:38850664-38850841178IPKA_BOVIN1-51511I:5-2420
2.4ENSBTAT000000107114ENSBTAE00000087092chr14:38854604-388560491446IPKA_BOVIN51-76260--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:337
 aligned with KAPCA_BOVIN | P00517 from UniProtKB/Swiss-Prot  Length:351

    Alignment length:337
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       
          KAPCA_BOVIN    15 SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF 351
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh......hhh.eeeeeeeeee..eeeeeeee.....eeeeeeeehhhhhhh.hhhhhhhhhhhhh.........eeeeee...eeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee..........hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh.........hhhhhhhhhhhh..............hhhhhhhhhhh..hhhhhhh........................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------PROTEIN_KINASE_ATP      -----------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------AGC_KINASE_CTER  PDB: A:298-350 UniProt: 299-351      PROSITE
           Transcript 1 (1) 1.--------------------Exon 1.3  PDB: A:36-78 UniProt: 37-79      Exon 1.4  PDB: A:79-111          Exon 1.5  PDB: A:112-139    ------------------------------------------Exon 1.7  PDB: A:182-213        Exon 1.8  PDB: A:214-254 UniProt: 215-255Exon 1.9  PDB: A:255-309 UniProt: 256-310              Exon 1.10  PDB: A:310-350                 Transcript 1 (1)
           Transcript 1 (2) -Exon 1.2  PDB: A:15-3-------------------------------------------------------------------------------------------------------Exon 1.6  PDB: A:139-181 UniProt: 140-182  ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 4c38 A  14 SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSYGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVLEYLPGGEMFSHLRRIGRFsEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWtLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVsINEKCGKEFSEF 350
                                    23        33        43        53        63        73        83        93       103       113       123       133     | 143       153       163       173       183       193   |   203       213       223       233       243       253       263       273       283       293       303       313       323       333    |  343       
                                                                                                                                                       139-SEP                                                   197-TPO                                                                                                                                      338-SEP        

Chain I from PDB  Type:PROTEIN  Length:20
 aligned with IPKA_BOVIN | Q3SX13 from UniProtKB/Swiss-Prot  Length:76

    Alignment length:20
                                    15        25
           IPKA_BOVIN     6 TTYADFIASGRTGRRNAIHD  25
               SCOP domains -------------------- SCOP domains
               CATH domains -------------------- CATH domains
               Pfam domains -------------------- Pfam domains
         Sec.struct. author hhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) -------------------- SAPs(SNPs)
                    PROSITE -------------------- PROSITE
               Transcript 2 Exon 2.3  PDB: I:5-2 Transcript 2
                 4c38 I   5 TTYADFIASGRTGRRNAIHD  24
                                    14        24

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4C38)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4C38)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4C38)

(-) Gene Ontology  (51, 53)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (KAPCA_BOVIN | P00517)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0004691    cAMP-dependent protein kinase activity    Catalysis of the reaction: ATP + a protein = ADP + a phosphoprotein. This reaction requires the presence of cAMP.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0034237    protein kinase A regulatory subunit binding    Interacting selectively and non-covalently with one or both of the regulatory subunits of protein kinase A.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0004712    protein serine/threonine/tyrosine kinase activity    Catalysis of the reactions: ATP + a protein serine = ADP + protein serine phosphate; ATP + a protein threonine = ADP + protein threonine phosphate; and ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0071333    cellular response to glucose stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
    GO:0071374    cellular response to parathyroid hormone stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a parathyroid hormone stimulus.
    GO:0001707    mesoderm formation    The process that gives rise to the mesoderm. This process pertains to the initial formation of the structure from unspecified parts.
    GO:0050804    modulation of chemical synaptic transmission    Any process that modulates the frequency or amplitude of synaptic transmission, the process of communication from a neuron to a target (neuron, muscle, or secretory cell) across a synapse. Amplitude, in this case, refers to the change in postsynaptic membrane potential due to a single instance of synaptic transmission.
    GO:1901621    negative regulation of smoothened signaling pathway involved in dorsal/ventral neural tube patterning    Any process that stops, prevents or reduces the frequency, rate or extent of smoothened signaling pathway involved in dorsal/ventral neural tube patterning.
    GO:0001843    neural tube closure    The last step in the formation of the neural tube, where the paired neural folds are brought together and fuse at the dorsal midline.
    GO:0018105    peptidyl-serine phosphorylation    The phosphorylation of peptidyl-serine to form peptidyl-O-phospho-L-serine.
    GO:0018107    peptidyl-threonine phosphorylation    The phosphorylation of peptidyl-threonine to form peptidyl-O-phospho-L-threonine.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0071158    positive regulation of cell cycle arrest    Any process that increases the rate, frequency, or extent of cell cycle arrest, the process in which the cell cycle is halted during one of the normal phases.
    GO:0046827    positive regulation of protein export from nucleus    Any process that activates or increases the frequency, rate or extent of directed movement of proteins from the nucleus into the cytoplasm.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:2000810    regulation of bicellular tight junction assembly    Any process that modulates the frequency, rate or extent of tight junction assembly.
    GO:0045667    regulation of osteoblast differentiation    Any process that modulates the frequency, rate or extent of osteoblast differentiation.
    GO:0061136    regulation of proteasomal protein catabolic process    Any process that modulates the rate, frequency, or extent of the chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome.
    GO:0070613    regulation of protein processing    Any process that modulates the frequency, rate or extent of protein processing, any protein maturation process achieved by the cleavage of a peptide bond or bonds within a protein.
    GO:0048240    sperm capacitation    A process required for sperm to reach fertilization competence. Sperm undergo an incompletely understood series of morphological and molecular maturational processes, termed capacitation, involving, among other processes, protein tyrosine phosphorylation and increased intracellular calcium.
cellular component
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0097546    ciliary base    Area of the cilium (also called flagellum) where the basal body and the axoneme are anchored to the plasma membrane. The ciliary base encompasses the distal part of the basal body, transition fibers and transition zone and is structurally and functionally very distinct from the rest of the cilium. In this area proteins are sorted and filtered before entering the cilium, and many ciliary proteins localize specifically to this area.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0031594    neuromuscular junction    The junction between the axon of a motor neuron and a muscle fiber. In response to the arrival of action potentials, the presynaptic button releases molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane of the muscle fiber, leading to a change in post-synaptic potential.
    GO:0031588    nucleotide-activated protein kinase complex    A protein complex that possesses nucleotide-dependent protein kinase activity. The nucleotide can be AMP (in S. pombe and human) or ADP (in S. cerevisiae).
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0044853    plasma membrane raft    A membrane raft that is part of the plasma membrane.
    GO:0097225    sperm midpiece    The highly organized segment of the sperm flagellum which begins at the connecting piece and is characterized by the presence of 9 outer dense fibers (ODFs) that lie outside each of the 9 outer axonemal microtubule doublets and by a sheath of mitochondria that encloses the ODFs and the axoneme; the midpiece terminates about one-fourth of the way down the sperm flagellum at the annulus, which marks the beginning of the principal piece.

Chain I   (IPKA_BOVIN | Q3SX13)
molecular function
    GO:0004862    cAMP-dependent protein kinase inhibitor activity    Stops, prevents or reduces the activity of a cAMP-dependent protein kinase.
    GO:0034236    protein kinase A catalytic subunit binding    Interacting selectively and non-covalently with one or both of the catalytic subunits of protein kinase A.
    GO:0004860    protein kinase inhibitor activity    Stops, prevents or reduces the activity of a protein kinase, an enzyme which phosphorylates a protein.
biological process
    GO:2000480    negative regulation of cAMP-dependent protein kinase activity    Any process that stops, prevents or reduces the frequency, rate or extent of cAMP-dependent protein kinase activity.
    GO:0043086    negative regulation of catalytic activity    Any process that stops or reduces the activity of an enzyme.
    GO:0042308    negative regulation of protein import into nucleus    Any process that stops, prevents, or reduces the frequency, rate or extent of the movement of proteins from the cytoplasm into the nucleus.
    GO:0006469    negative regulation of protein kinase activity    Any process that stops, prevents, or reduces the frequency, rate or extent of protein kinase activity.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0010389    regulation of G2/M transition of mitotic cell cycle    Any process that modulates the rate or extent of progression from G2 phase to M phase of the mitotic cell cycle.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MOH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SEP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TPO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    VUP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4c38)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4c38
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IPKA_BOVIN | Q3SX13
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  KAPCA_BOVIN | P00517
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.11
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IPKA_BOVIN | Q3SX13
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  KAPCA_BOVIN | P00517
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IPKA_BOVIN | Q3SX132gnj 2uzt 2uzu 2uzv 2uzw 3e8c 3e8e 3zo1 3zo2 3zo3 3zo4 4c33 4c34 4c35 4c36 4c37 4yxr
        KAPCA_BOVIN | P005171cdk 1cmk 1kmu 1kmw 1q24 1q61 1q62 1q8t 1q8u 1q8w 1smh 1stc 1sve 1svg 1svh 1szm 1veb 1xh4 1xh5 1xh6 1xh7 1xh8 1xh9 1xha 1ydr 1yds 1ydt 2c1a 2c1b 2f7e 2f7x 2f7z 2gfc 2gnf 2gng 2gnh 2gni 2gnj 2gnl 2jds 2jdt 2jdv 2oh0 2ojf 2uvx 2uvy 2uvz 2uw0 2uw3 2uw4 2uw5 2uw6 2uw7 2uw8 2uzt 2uzu 2uzv 2uzw 2vnw 2vny 2vo0 2vo3 2vo6 2vo7 3ag9 3bwj 3dnd 3dne 3e8c 3e8e 3kkv 3zo1 3zo2 3zo3 3zo4 4axa 4c33 4c34 4c35 4c36 4c37 4ie9 4ij9 4yxr 4yxs 4z83 4z84

(-) Related Entries Specified in the PDB File

4c33 PKA-S6K1 CHIMERA APO
4c34 PKA-S6K1 CHIMERA WITH STAUROSPORINE BOUND
4c35 PKA-S6K1 CHIMERA WITH COMPOUND 1 (NU1085) BOUND
4c36 PKA-S6K1 CHIMERA WITH COMPOUND 15E (CCT147581) BOUND
4c37 PKA-S6K1 CHIMERA WITH COMPOUND 21A (CCT196539) BOUND