Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCUTURE OF NATIVE PPAZOR
 
Authors :  A. M. D. Goncalves, D. De Sanctis, I. Bento
Date :  08 Aug 13  (Deposition) - 30 Oct 13  (Release) - 18 Dec 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. M. D. Goncalves, S. Mendes, D. De Sanctis, L. O. Martins, I. Bento
The Crystal Structure Of Pseudomonas Putida Azor: The Active Site Revisited.
Febs J. V. 280 6643 2013
PubMed-ID: 24127652  |  Reference-DOI: 10.1111/FEBS.12568

(-) Compounds

Molecule 1 - FMN-DEPENDENT NADH-AZOREDUCTASE 1
    Chains: A
    EC Number: 1.7.-.-, 1.6.5.2
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-21A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Variant: TUNER
    Expression System Vector Type: PLASMID
    Organism Scientific: PSEUDOMONAS PUTIDA
    Organism Taxid: 303
    Strain: MET94
    Synonym: AZO-DYE REDUCTASE 1, FMN-DEPENDENT NADH-AZO COMPOUND OXIDOREDUCTASE 1, AZOREDUCTASE

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
112P2Ligand/IonDODECAETHYLENE GLYCOL
2FMN1Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 1 (2, 6)
No.NameCountTypeFull Name
112P4Ligand/IonDODECAETHYLENE GLYCOL
2FMN2Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:9 , LEU A:11 , SER A:15 , ALA A:16 , SER A:17 , PRO A:94 , MET A:95 , TYR A:96 , ASN A:97 , PHE A:98 , THR A:139 , ALA A:140 , GLY A:141 , GLY A:142 , LEU A:177 , 12P A:1202 , HOH A:2045 , HOH A:2196 , HOH A:2296 , HOH A:2298BINDING SITE FOR RESIDUE FMN A1201
2AC2SOFTWAREASN A:97 , GLY A:142 , ALA A:178 , TYR A:179 , FMN A:1201 , HOH A:2228 , HOH A:2299 , HOH A:2300 , HOH A:2301BINDING SITE FOR RESIDUE 12P A1202
3AC3SOFTWARELEU A:55 , HOH A:2027BINDING SITE FOR RESIDUE 12P A1203

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4C0W)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4C0W)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4C0W)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4C0W)

(-) Exons   (0, 0)

(no "Exon" information available for 4C0W)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:201
 aligned with AZOR1_PSEPK | Q88IY3 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:201
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200 
          AZOR1_PSEPK     1 MKLLHIDSSILGDNSASRQLSREVVEAWKAADPSVEVVYRDLAADAIAHFSAATLVAAGTPEDVRDAAQAFEAKLSAETLEEFLAADAVVIGAPMYNFTVPTQLKAWIDRVAVAGKTFRYTEAGPQGLCGNKKVVLVSTAGGLHAGQPTGAGHEDFLKVFLGFIGITDLEIVRAHGLAYGPEQRSQAIDAAQAQIASELFA 201
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhhhhhhhhhhhh...eeeeee.........hhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.eeeeeee......hhhhhhhhhhhh.....eeee..eeee.....eeeeeee.......hhhhh.hhhhhhhhhhhh...eeeeeee.....hhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4c0w A   1 MKLLHIDSSILGDNSASRQLSREVVEAWKAADPSVEVVYRDLAADAIAHFSAATLVAAGTPEDVRDAAQAFEAKLSAETLEEFLAADAVVIGAPMYNFTVPTQLKAWIDRVAVAGKTFRYTEAGPQGLCGNKKVVLVSTAGGLHAGQPTGAGHEDFLKVFLGFIGITDLEIVRAHGLAYGPEQRSQAIDAAQAQIASELFA 201
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4C0W)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4C0W)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4C0W)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A   (AZOR1_PSEPK | Q88IY3)
molecular function
    GO:0010181    FMN binding    Interacting selectively and non-covalently with flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0008752    FMN reductase activity    Catalysis of the reaction: FMNH2 + NAD(P)+ = FMN + NAD(P)H + H+.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016652    oxidoreductase activity, acting on NAD(P)H, NAD(P) as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces NAD+ or NADP.
    GO:0016661    oxidoreductase activity, acting on other nitrogenous compounds as donors    Catalysis of an oxidation-reduction (redox) reaction in which a nitrogenous group, excluding NH and NH2 groups, acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    12P  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4c0w)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4c0w
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AZOR1_PSEPK | Q88IY3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.6.5.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  1.7.-.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  AZOR1_PSEPK | Q88IY3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AZOR1_PSEPK | Q88IY3: 4c0x 4c14

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4C0W)