Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYO-EM RECONSTRUCTION OF ENTEROVIRUS 71 IN COMPLEX WITH A NEUTRALIZING ANTIBODY E18
 
Authors :  P. Plevka, R. Perera, J. Cardosa, A. Suksatu, R. J. Kuhn, M. G. Rossmann
Date :  08 Aug 13  (Deposition) - 05 Feb 14  (Release) - 26 Feb 14  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  10.00
Chains :  Asym. Unit :  A,B,C,Y,Z
Biol. Unit 1:  A,B,C,Y,Z  (60x)
Keywords :  Virus-Immune System Complex, Virus, Pathogen, Ev71 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Plevka, P. Lim, R. Perera, J. Cardosa, A. Suksatu, R. J. Kuhn, M. G. Rossmann
Neutralizing Antibodies Can Initiate Genome Release From Human Enterovirus 71.
Proc. Natl. Acad. Sci. Usa V. 111 2134 2014
PubMed-ID: 24469789  |  Reference-DOI: 10.1073/PNAS.1320624111

(-) Compounds

Molecule 1 - VP1
    Chains: A
    Organism Scientific: HUMAN ENTEROVIRUS 71
    Organism Taxid: 39054
    Strain: MY104-9-SAR-97
 
Molecule 2 - VP2
    Chains: B
    Organism Scientific: HUMAN ENTEROVIRUS 71
    Organism Taxid: 39054
    Strain: MY104-9-SAR-97
 
Molecule 3 - VP3
    Chains: C
    Organism Scientific: HUMAN ENTEROVIRUS 71
    Organism Taxid: 39054
    Strain: MY104-9-SAR-97
 
Molecule 4 - FAB EV18 4 D6-1 F1 G9
    Chains: Y
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Other Details: SEQUENCE MODELLED AS UNK
 
Molecule 5 - FAB EV18 4 D6-1 F1 G9
    Chains: Z
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Other Details: SEQUENCE MODELLED AS UNK

 Structural Features

(-) Chains, Units

  12345
Asymmetric Unit : ABCYZ
Biological Unit 1 (60x): ABCYZ

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 437)

Asymmetric Unit (1, 437)
No.NameCountTypeFull Name
1UNK437Mod. Amino Acid
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1UNK-1Mod. Amino Acid

(-) Sites  (0, 0)

(no "Site" information available for 4C0U)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4C0U)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Unk Y:7 -Unk Y:8
2Unk Y:144 -Unk Y:145
3Unk Z:371 -Unk Z:372
4Unk Z:413 -Unk Z:414

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4C0U)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4C0U)

(-) Exons   (0, 0)

(no "Exon" information available for 4C0U)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:225
 aligned with A9X4C2_9ENTO | A9X4C2 from UniProtKB/TrEMBL  Length:2193

    Alignment length:225
                                   647       657       667       677       687       697       707       717       727       737       747       757       767       777       787       797       807       817       827       837       847       857     
         A9X4C2_9ENTO   638 HSTAETTLDSFFSRAGLVGEIDLPLEGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGQVVPQLLQYMFVPPGAPKPESRESLAWQTATNPSVFVKLTDPPAQVSVPFMSPASAYQWFYDGYPTFGEHKQEKDLEYGACPNNMMGTFSVRNVGSSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGTSRTAITTL 862
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh..eeeeeeee..........eeeee.hhhhhhhhhhhhh.eeeeeeeeeeeeeee.........eeeeeee...........hhhhhh....eeeee.....eeeee........ee............hhhhhhhh..hhhhh..eeeeee.........eeeeeeeeeeeeeeeee.................................. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4c0u A  73 HSTAETTLDSFFSRAGLVGEIDLPLEGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGQVVPQLLQYMFVPPGAPKPESRESLAWQTATNPSVFVKLTDPPAQVSVPFMSPASAYQWFYDGYPTFGEHKQEKDLEYGACPNNMMGTFSVRNVGSSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGTSRTAITTL 297
                                    82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292     


Chain B from PDB  Type:PROTEIN  Length:244
 aligned with A9X4C2_9ENTO | A9X4C2 from UniProtKB/TrEMBL  Length:2193

    Alignment length:244
                                    89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319    
         A9X4C2_9ENTO    80 DRVAQLTIGNSTITTQEAANIIVGYGEWPSYCSDDDATAVDKPTRPDVSVNRFYTLDTKLWEKSSKGWYWKFPDVLTETGVFGQNAQFHYLYRSGFCIHVQCNASKFHQGALLVAILPEYVIGTVAGGTGTEDSHPPYKQTQPGADGFELQHPYVLDAGIPISQLTVCPHQWINLRTNNCATIIVPYMNTLPFDSALNHCNFGLLVVPISPLDFDQGATPVIPITITLAPMCSEFAGLRQAVTQ 323
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..eeeee......ee.hhh..................hhhhh...eeeeeeee......eeeehhhhh..hhhhhhhhhheeeeeeeeeeeee.......eeeeeeeeee..................hhhhhhhhhhhee..hhhhh....hhhhhhhh.eeeee.....eeeeee................eeeeeeeeeeee........eeeeeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4c0u B  11 DRVAQLTIGNSTITTQEAANIIVGYGEWPSYCSDDDATAVDKPTRPDVSVNRFYTLDTKLWEKSSKGWYWKFPDVLTETGVFGQNAQFHYLYRSGFCIHVQCNASKFHQGALLVAILPEYVIGTVAGGTGTEDSHPPYKQTQPGADGFELQHPYVLDAGIPISQLTVCPHQWINLRTNNCATIIVPYMNTLPFDSALNHCNFGLLVVPISPLDFDQGATPVIPITITLAPMCSEFAGLRQAVTQ 254
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250    


Chain C from PDB  Type:PROTEIN  Length:242
 aligned with A9X4C2_9ENTO | A9X4C2 from UniProtKB/TrEMBL  Length:2193

    Alignment length:242
                                   333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563  
         A9X4C2_9ENTO   324 GFPTEPKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRDGPWQSTMLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDTSHILQTASIQ 565
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................ee...............ee..hhhhhh..eee..........hhhhhhheeee.......eeeeee......hhhhhhhhhhhhh.eeeee..eeeeeee........eeeeeee........hhhhhh..eeeeee.....eeeeee........ee....hhhhhhh..eeeeee............eeeeeeeeee....eeeee............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4c0u C   1 GFPTEPKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRDGPWQSTMLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDTSHILQTASIQ 242
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240  


Chain Y from PDB  Type:PROTEIN  Length:217
                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeee.....eeeeeee....ee..ee.eeeeee......eeee.............eeeeee..eeeeee...hhhhheeeeeee...........eeeee.......eeeee..hhhhhhh.eeeeeeeeeee....eeeeeee..eee...eeeeee........eeeeeeeeeehhhhhh..eeeeeeee......eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4c0u Y   1 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx 217
                            ||||||||10||||||||20||||||||30||||||||40||||||||50||||||||60||||||||70||||||||80||||||||90|||||||100|||||||110|||||||120|||||||130|||||||140|||||||150|||||||160|||||||170|||||||180|||||||190|||||||200|||||||210|||||||
                            1-UNK|||10-UNK|||19-UNK|||28-UNK|||37-UNK|||46-UNK|||55-UNK|||64-UNK|||73-UNK|||82-UNK|||91-UNK||100-UNK||109-UNK||118-UNK||127-UNK||136-UNK||145-UNK||154-UNK||163-UNK||172-UNK||181-UNK||190-UNK||199-UNK||208-UNK||217-UNK
                             2-UNK|||11-UNK|||20-UNK|||29-UNK|||38-UNK|||47-UNK|||56-UNK|||65-UNK|||74-UNK|||83-UNK|||92-UNK||101-UNK||110-UNK||119-UNK||128-UNK||137-UNK||146-UNK||155-UNK||164-UNK||173-UNK||182-UNK||191-UNK||200-UNK||209-UNK||| 
                              3-UNK|| 12-UNK|| 21-UNK|| 30-UNK|| 39-UNK|| 48-UNK|| 57-UNK|| 66-UNK|| 75-UNK|| 84-UNK|| 93-UNK||102-UNK||111-UNK||120-UNK||129-UNK||138-UNK||147-UNK||156-UNK||165-UNK||174-UNK||183-UNK||192-UNK||201-UNK||210-UNK|| 
                               4-UNK|  13-UNK|  22-UNK|  31-UNK|  40-UNK|  49-UNK|  58-UNK|  67-UNK|  76-UNK|  85-UNK|  94-UNK| 103-UNK| 112-UNK| 121-UNK| 130-UNK| 139-UNK| 148-UNK| 157-UNK| 166-UNK| 175-UNK| 184-UNK| 193-UNK| 202-UNK| 211-UNK| 
                                5-UNK   14-UNK   23-UNK   32-UNK   41-UNK   50-UNK   59-UNK   68-UNK   77-UNK   86-UNK   95-UNK  104-UNK  113-UNK  122-UNK  131-UNK  140-UNK  149-UNK  158-UNK  167-UNK  176-UNK  185-UNK  194-UNK  203-UNK  212-UNK 
                                 6-UNK   15-UNK   24-UNK   33-UNK   42-UNK   51-UNK   60-UNK   69-UNK   78-UNK   87-UNK   96-UNK  105-UNK  114-UNK  123-UNK  132-UNK  141-UNK  150-UNK  159-UNK  168-UNK  177-UNK  186-UNK  195-UNK  204-UNK  213-UNK
                                  7-UNK   16-UNK   25-UNK   34-UNK   43-UNK   52-UNK   61-UNK   70-UNK   79-UNK   88-UNK   97-UNK  106-UNK  115-UNK  124-UNK  133-UNK  142-UNK  151-UNK  160-UNK  169-UNK  178-UNK  187-UNK  196-UNK  205-UNK  214-UNK
                                   8-UNK   17-UNK   26-UNK   35-UNK   44-UNK   53-UNK   62-UNK   71-UNK   80-UNK   89-UNK   98-UNK  107-UNK  116-UNK  125-UNK  134-UNK  143-UNK  152-UNK  161-UNK  170-UNK  179-UNK  188-UNK  197-UNK  206-UNK  215-UNK
                                    9-UNK   18-UNK   27-UNK   36-UNK   45-UNK   54-UNK   63-UNK   72-UNK   81-UNK   90-UNK   99-UNK  108-UNK  117-UNK  126-UNK  135-UNK  144-UNK  153-UNK  162-UNK  171-UNK  180-UNK  189-UNK  198-UNK  207-UNK  216-UNK


Chain Z from PDB  Type:PROTEIN  Length:220
                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..eee.....eeeeeeee..hhhh..eeeeeee...eeeeeeee......eee.hhhh..eeeeee....eeeeee...hhhh.eeeeeee...............eeeee........eeeee...hhhh...eeeeeeeee.......eeee.hhh....eee...eee..eeeeeeeeeeeeehhhhh..eeeeeehhhheeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4c0u Z 219 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx 438
                            |||||||228|||||||238|||||||248|||||||258|||||||268|||||||278|||||||288|||||||298|||||||308|||||||318|||||||328|||||||338|||||||348|||||||358|||||||368|||||||378|||||||388|||||||398|||||||408|||||||418|||||||428|||||||438
                            ||||||227-UNK||236-UNK||245-UNK||254-UNK||263-UNK||272-UNK||281-UNK||290-UNK||299-UNK||308-UNK||317-UNK||326-UNK||335-UNK||344-UNK||353-UNK||362-UNK||371-UNK||380-UNK||389-UNK||398-UNK||407-UNK||416-UNK||425-UNK||434-UNK
                          219-UNK||228-UNK||237-UNK||246-UNK||255-UNK||264-UNK||273-UNK||282-UNK||291-UNK||300-UNK||309-UNK||318-UNK||327-UNK||336-UNK||345-UNK||354-UNK||363-UNK||372-UNK||381-UNK||390-UNK||399-UNK||408-UNK||417-UNK||426-UNK||435-UNK
                           220-UNK||229-UNK||238-UNK||247-UNK||256-UNK||265-UNK||274-UNK||283-UNK||292-UNK||301-UNK||310-UNK||319-UNK||328-UNK||337-UNK||346-UNK||355-UNK||364-UNK||373-UNK||382-UNK||391-UNK||400-UNK||409-UNK||418-UNK||427-UNK||436-UNK
                            221-UNK| 230-UNK| 239-UNK| 248-UNK| 257-UNK| 266-UNK| 275-UNK| 284-UNK| 293-UNK| 302-UNK| 311-UNK| 320-UNK| 329-UNK| 338-UNK| 347-UNK| 356-UNK| 365-UNK| 374-UNK| 383-UNK| 392-UNK| 401-UNK| 410-UNK| 419-UNK| 428-UNK| 437-UNK
                             222-UNK  231-UNK  240-UNK  249-UNK  258-UNK  267-UNK  276-UNK  285-UNK  294-UNK  303-UNK  312-UNK  321-UNK  330-UNK  339-UNK  348-UNK  357-UNK  366-UNK  375-UNK  384-UNK  393-UNK  402-UNK  411-UNK  420-UNK  429-UNK  438-UNK
                              223-UNK  232-UNK  241-UNK  250-UNK  259-UNK  268-UNK  277-UNK  286-UNK  295-UNK  304-UNK  313-UNK  322-UNK  331-UNK  340-UNK  349-UNK  358-UNK  367-UNK  376-UNK  385-UNK  394-UNK  403-UNK  412-UNK  421-UNK  430-UNK    
                               224-UNK  233-UNK  242-UNK  251-UNK  260-UNK  269-UNK  278-UNK  287-UNK  296-UNK  305-UNK  314-UNK  323-UNK  332-UNK  341-UNK  350-UNK  359-UNK  368-UNK  377-UNK  386-UNK  395-UNK  404-UNK  413-UNK  422-UNK  431-UNK   
                                225-UNK  234-UNK  243-UNK  252-UNK  261-UNK  270-UNK  279-UNK  288-UNK  297-UNK  306-UNK  315-UNK  324-UNK  333-UNK  342-UNK  351-UNK  360-UNK  369-UNK  378-UNK  387-UNK  396-UNK  405-UNK  414-UNK  423-UNK  432-UNK  
                                 226-UNK  235-UNK  244-UNK  253-UNK  262-UNK  271-UNK  280-UNK  289-UNK  298-UNK  307-UNK  316-UNK  325-UNK  334-UNK  343-UNK  352-UNK  361-UNK  370-UNK  379-UNK  388-UNK  397-UNK  406-UNK  415-UNK  424-UNK  433-UNK
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4C0U)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4C0U)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4C0U)

(-) Gene Ontology  (37, 37)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (A9X4C2_9ENTO | A9X4C2)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003724    RNA helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a RNA helix.
    GO:0003968    RNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1); uses an RNA template, i.e. the catalysis of RNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time.
    GO:0004197    cysteine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0008234    cysteine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0005216    ion channel activity    Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0017111    nucleoside-triphosphatase activity    Catalysis of the reaction: a nucleoside triphosphate + H2O = nucleoside diphosphate + phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0018144    RNA-protein covalent cross-linking    The formation of a covalent cross-link between RNA and a protein.
    GO:0034220    ion transmembrane transport    A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0039707    pore formation by virus in membrane of host cell    The aggregation, arrangement and bonding together of a set of components by a virus to form a pore complex in a membrane of a host organism.
    GO:0051259    protein oligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers; protein oligomers may be composed of different or identical monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0001172    transcription, RNA-templated    The cellular synthesis of RNA on a template of RNA.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0039694    viral RNA genome replication    The replication of a viral RNA genome.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0019062    virion attachment to host cell    The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
cellular component
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.
    GO:0044161    host cell cytoplasmic vesicle    A vesicle formed of membrane or protein, found in the cytoplasm of a host cell.
    GO:0044162    host cell cytoplasmic vesicle membrane    The lipid bilayer surrounding a host cell cytoplasmic vesicle.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0044385    integral to membrane of host cell    Penetrating at least one phospholipid bilayer of a membrane. May also refer to the state of being buried in the bilayer with no exposure outside the bilayer. When used to describe a protein, indicates that all or part of the peptide sequence is embedded in the membrane. Occurring in a host cell.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    UNK  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 4c0u)
 
  Cis Peptide Bonds
    Unk Y:144 - Unk Y:145   [ RasMol ]  
    Unk Y:7 - Unk Y:8   [ RasMol ]  
    Unk Z:371 - Unk Z:372   [ RasMol ]  
    Unk Z:413 - Unk Z:414   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4c0u
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A9X4C2_9ENTO | A9X4C2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A9X4C2_9ENTO | A9X4C2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A9X4C2_9ENTO | A9X4C2: 3zfe 3zff 3zfg 4aed 4c0y 4c10

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4C0U)