4BTF - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   STRUCTURE OF MLKL

Authors :   P. E. Czabotar, J. M. Murphy

Date :   16 Jun 13 (Deposition) - 18 Sep 13 (Release) - 09 Oct 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.60

Chains :   Asym./Biol. Unit : A

Keywords :   Transferase, Pseduokinase, Necroptosis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. M. Murphy, P. E. Czabotar, J. M. Hildebrand, I. S. Lucet, J. -G. Zhang S. Alvarez-Diaz, R. Lewis, N. Lalaoui, D. Metcalf, A. I. Webb, S. N. Young, L. N. Varghese, G. M. Tannahill, E. C. Hatchell, I. J. Majewski, T. Okamoto, R. C. J. Dobson, D. J. Hilton, J. J. Babon, N. A. Nicola, A. Strasser, J. Silke, W. S. Alexander
The Pseudokinase Mlkl Mediates Necroptosis Via A Molecular Switch Mechanism
Immunity V. 39 443 2013
PubMed-ID: 24012422 | Reference-DOI: 10.1016/J.IMMUNI.2013.06.018

Molecule 1 - MIXED LINEAGE KINASE DOMAIN-LIKE PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Cell Line	:	SF21
	Expression System Common	:	FALL ARMYWORM
	Expression System Taxid	:	7108
	Expression System Vector	:	PFASTBAC HTB
	Expression System Vector Type	:	PLASMID
	Organism Common	:	HOUSE MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090
	Synonym	:	MLKL

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 3)

No.	Name	Count	Type	Full Name
1	EDO	2	Ligand/Ion	1,2-ETHANEDIOL
2	FMT	1	Ligand/Ion	FORMIC ACID

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	VAL A:364 , ARG A:368 , TYR A:376	BINDING SITE FOR RESIDUE FMT A1456
2	AC2	SOFTWARE	HIS A:190 , TYR A:211 , HIS A:212	BINDING SITE FOR RESIDUE EDO A1457

(no "SS Bond" information available for 4BTF)

Asymmetric/Biological Unit

No.	Residues
1	Pro A:193	-	Pro A:194
2	Lys A:264	-	Pro A:265

(no "SAP(SNP)/Variant" information available for 4BTF)

(no "PROSITE Motif" information available for 4BTF)

Asymmetric/Biological Unit (10, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSMUST00000056157	1	ENSMUSE00000716754	chr8:113862077-113861724	354	MLKL_MOUSE	-	0	0	-	-
1.3a	ENSMUST00000056157	3a	ENSMUSE00000362813	chr8:113857654-113857222	433	MLKL_MOUSE	1-144	144	1	A:2-144 (gaps)	143
1.4	ENSMUST00000056157	4	ENSMUSE00000910243	chr8:113855790-113855717	74	MLKL_MOUSE	144-169	26	1	A:144-169	26
1.5	ENSMUST00000056157	5	ENSMUSE00000214986	chr8:113851898-113851715	184	MLKL_MOUSE	169-230	62	1	A:169-230 (gaps)	62
1.6	ENSMUST00000056157	6	ENSMUSE00000214982	chr8:113846700-113846603	98	MLKL_MOUSE	230-263	34	1	A:230-263	34
1.7	ENSMUST00000056157	7	ENSMUSE00000214985	chr8:113843752-113843617	136	MLKL_MOUSE	263-308	46	1	A:263-308	46
1.8	ENSMUST00000056157	8	ENSMUSE00000214984	chr8:113843353-113843278	76	MLKL_MOUSE	308-333	26	1	A:308-333	26
1.9	ENSMUST00000056157	9	ENSMUSE00000214988	chr8:113840414-113840263	152	MLKL_MOUSE	334-384	51	1	A:334-384 (gaps)	51
1.11	ENSMUST00000056157	11	ENSMUSE00000579984	chr8:113839442-113839393	50	MLKL_MOUSE	384-401	18	1	A:384-401	18
1.12b	ENSMUST00000056157	12b	ENSMUSE00000308058	chr8:113839005-113838841	165	MLKL_MOUSE	401-456	56	1	A:401-448	48
1.13c	ENSMUST00000056157	13c	ENSMUSE00000840754	chr8:113835977-113835697	281	MLKL_MOUSE	456-472	17	1	A:449-455	7

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:413
 aligned with MLKL_MOUSE | Q9D2Y4 from UniProtKB/Swiss-Prot  Length:472

    Alignment length:462
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461  
           MLKL_MOUSE     2 DKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVLRAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTAKSTKAERSSSTIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGRSLSGRERILERLSA 463
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh----------------..hhhhhhhhhhhhhhhhhhh..-----------..hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.------.......ee.hhhhh....eeeee...eeeeeeee..eeeeeeee......hhhhhhhhhhhhhhh...........eeeeeee......eeeeeee.....hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh...........eeee...eeee....hhhhhhhhh...--------.hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh...........hhhhhhhhhhhh..hhhhh.hhhh--------hhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.3a  PDB: A:2-144 (gaps) UniProt: 1-144 [INCOMPLETE]                                                                                     ------------------------Exon 1.5  PDB: A:169-230 (gaps) UniProt: 169-230              --------------------------------Exon 1.7  PDB: A:263-308 UniProt: 263-308     ---------------------------------------------------------------------------Exon 1.11         ------------------------------------------------------1.13c    Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------Exon 1.4  PDB: A:144-169  ------------------------------------------------------------Exon 1.6  PDB: A:230-263          --------------------------------------------Exon 1.8  PDB: A:308-333  Exon 1.9  PDB: A:334-384 (gaps) UniProt: 334-384   ----------------Exon 1.12b  PDB: A:401-448 UniProt: 401-456 [INCOMPLETE]------- Transcript 1 (2)
                 4btf A   2 DKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKF----------------ILFHEVNEKLRDVWEELLLLLQV-----------PASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCS------IPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVLRAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTA--------SSTIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDG--------ILERLSA 455
                                    11        21        31        41        51        61        71      |  -         -   |   101       111     |   -       131       141       151       161        |-     | 181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341        |-       361       371       381       391       401       411       421       431       441      |  -     | 453  
                                                                                                       78               95                   117         129                                      170    177                                                                                                                                                                          350      359                                                                                      448      449

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 4BTF)

(no "CATH Domain" information available for 4BTF)

(no "Pfam Domain" information available for 4BTF)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (MLKL_MOUSE | Q9D2Y4)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
	GO:0070266	necroptotic process	A programmed necrotic cell death process which begins when a cell receives a signal (e.g. a ligand binding to a death receptor or to a Toll-like receptor), and proceeds through a series of biochemical events (signaling pathways), characterized by activation of receptor-interacting serine/threonine-protein kinase 1 and/or 3 (RIPK1/3, also called RIP1/3) and by critical dependence on mixed lineage kinase domain-like (MLKL), and which typically lead to common morphological features of necrotic cell death. The process ends when the cell has died. The process is divided into a signaling phase, and an execution phase, which is triggered by the former.
	GO:0012501	programmed cell death	A process which begins when a cell receives an internal or external signal and activates a series of biochemical events (signaling pathway). The process ends with the death of the cell.
	GO:0070207	protein homotrimerization	The formation of a protein homotrimer, a macromolecular structure consisting of three noncovalently associated identical subunits.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FMT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Lys A:264 - Pro A:265	[ RasMol ]
		Pro A:193 - Pro A:194	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4btf
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MLKL_MOUSE \| Q9D2Y4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MLKL_MOUSE \| Q9D2Y4
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	MLKL_MOUSE \| Q9D2Y4	:	4m68 4m69

(no "Related Entries Specified in the PDB File" available for 4BTF)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 3)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (10, 10)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (12, 12)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File