Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  GLOBIN-LIKE PROTEIN GLB-12 FROM C.ELEGANS
 
Authors :  S. De Henau, L. Tilleman, F. Germani, M. Pauwels, C. Vlaeminck, J. R. Vanfleteren, W. Bert, A. Pesce, M. Nardini, M. Bolognesi, K. De W L. Moens, S. Dewilde, B. P. Braeckman
Date :  17 Apr 13  (Deposition) - 07 May 14  (Release) - 16 Dec 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. De Henau, L. Tilleman, M. Vangheel, E. Luyckx, S. Trashin, M. Pauwels, F. Germani, C. Vlaeminck, J. R. Vanfleteren, W. Bert, A. Pesce, M. Nardini, M. Bolognesi, K. De Wael, L. Moens, S. Dewilde, B. P. Braeckman
A Redox Signalling Globin Is Essential For Reproduction In Caenorhabditis Elegans.
Nat. Commun. V. 6 8782 2015
PubMed-ID: 26621324  |  Reference-DOI: 10.1038/NCOMMS9782

(-) Compounds

Molecule 1 - PROTEIN GLB-12
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Mutation: YES
    Organism Scientific: CAENORHABDITIS ELEGANS
    Organism Taxid: 6239
    Synonym: HEMOGLOBIN

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 6)

Asymmetric Unit (3, 6)
No.NameCountTypeFull Name
1ACT4Ligand/IonACETATE ION
2HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
3SO41Ligand/IonSULFATE ION
Biological Unit 1 (3, 12)
No.NameCountTypeFull Name
1ACT8Ligand/IonACETATE ION
2HEM2Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
3SO42Ligand/IonSULFATE ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:45 , VAL A:72 , PHE A:73 , LYS A:88 , GLY A:91 , HIS A:92 , ARG A:95 , PHE A:96 , PHE A:99 , THR A:109 , SER A:126 , HIS A:127 , GLN A:130 , LEU A:133 , TYR A:144 , PHE A:145 , VAL A:148 , MET A:203 , ACT A:1218BINDING SITE FOR RESIDUE HEM A 300
2AC2SOFTWARETRP A:19 , ARG A:121 , ARG A:125 , SER A:206 , LEU A:209 , HOH A:2001 , HOH A:2108BINDING SITE FOR RESIDUE SO4 A1216
3AC3SOFTWAREASN A:33 , LYS A:34 , HOH A:2013BINDING SITE FOR RESIDUE ACT A1217
4AC4SOFTWAREARG A:41 , GLN A:45 , SER A:105 , THR A:109 , GLN A:130 , HEM A:300 , HOH A:2065 , HOH A:2081BINDING SITE FOR RESIDUE ACT A1218
5AC5SOFTWAREASN A:22 , ASP A:76 , ARG A:77 , THR A:114 , HOH A:2004 , HOH A:2044 , HOH A:2049 , HOH A:2071 , HOH A:2112BINDING SITE FOR RESIDUE ACT A1219
6AC6SOFTWAREARG A:77 , HOH A:2069 , HOH A:2070BINDING SITE FOR RESIDUE ACT A1220

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4BJA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4BJA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4BJA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4BJA)

(-) Exons   (0, 0)

(no "Exon" information available for 4BJA)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:182
 aligned with Q09514_CAEEL | Q09514 from UniProtKB/TrEMBL  Length:266

    Alignment length:197
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       
         Q09514_CAEEL    19 WVGNESENPFDLALNKKDRTLLRETWQRLDDPKDIVGLIFLDIVNDIEPDLKKVFGVDRAPRAAMLKMPKFGGHILRFYEFMEQLTSMLGTSENLTGAWQLVRKTGRSHVRQGFLEQNQNQMEKNYFEIVINVFIERLIPFLTGEQELPSSEGKENKKVRFAQNYTTSQITDVWKKFLNTVISQMTDSFELERAKQK 215
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhh.....hhhhhhhhhhhhhhhhhhh.....---------------..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4bja A  19 WVGNESENPFDLALNKKDRTLLRETWQRLDDPKDIVGLIFLDIVNDIEPDLKKVFGVDRAPRAAMLKMPKFGGHILRFYEFMEQLTSMLGTSENLTGAWQLVRKTGRSHVRQGFLEQNQNQMEKNYFEIVINVFIERLIPFLTGEQEL---------------NYTTSQITDVWKKFLNTVISQMTDSFELERAKQK 215
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       | -         -   |   188       198       208       
                                                                                                                                                                             166             182
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4BJA)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4BJA)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4BJA)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q09514_CAEEL | Q09514)
molecular function
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019825    oxygen binding    Interacting selectively and non-covalently with oxygen (O2).
    GO:0005344    oxygen transporter activity    Enables the directed movement of oxygen into, out of or within a cell, or between cells.
biological process
    GO:0015671    oxygen transport    The directed movement of oxygen (O2) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4bja)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4bja
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q09514_CAEEL | Q09514
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q09514_CAEEL | Q09514
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4BJA)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4BJA)