|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric/Biological Unit (2, 4) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 4B9P) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 4B9P) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 4B9P) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 4B9P) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:166 aligned with RSGI2_CLOTH | A3DC27 from UniProtKB/Swiss-Prot Length:671 Alignment length:166 515 525 535 545 555 565 575 585 595 605 615 625 635 645 655 665 RSGI2_CLOTH 506 TDLLTKIELQAYNHIRTSETKELQPRIKLINTGNTPITLSEVKIRYYYTKDQVINEIYTCDWSNITSSKITGTVVQMSNPKPNADSYVEIGFTNSAGVLNPGEYVEIISRIGNSYALSLATPPYSEWNYMYDQNSDYSFNNSSSDFVVWDKITVYISGTLYWGIEP 671 SCOP domains d4b9pa_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --CBM3 PDB: A:3-166 UniProt: 508-671 PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 4b9p A 1 TDLLTKIELQAYNHIRTSETKELQPRIKLINTGNTPITLSEVKIRYYYTKDQVINEIYTCDWSNITSSKITGTVVQMSNPKPNADSYVEIGFTNSAGVLNPGEYVEIISRIGNSYALSLATPPYSEWNYMYDQNSDYSFNNSSSDFVVWDKITVYISGTLYWGIEP 166 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 4B9P) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 4B9P) |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RSGI2_CLOTH | A3DC27)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|