Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF THE CELL WALL ANCHOR OF THE T6SS FROM PSEUDOMONAS AERUGINOSA
 
Authors :  C. S. Robb, M. Carlson, F. E. Nano, A. B. Boraston
Date :  08 Aug 12  (Deposition) - 02 Oct 13  (Release) - 02 Oct 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.45
Chains :  Asym./Biol. Unit :  A
Keywords :  Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. S. Robb, M. Carlson, F. E. Nano, A. B. Boraston
Crystal Structure Of The Periplasmic Peptidoglycan Binding Anchor Of A T6Ss From Pseudomonas Aeruginosa.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - TSSL1
    Atcc47085D-5
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VectorPET28
    Expression System Vector TypePLASMID
    FragmentPEPTIDOGLYCAN BINDING MODULE, RESIDUES 299-449
    Organism ScientificPSEUDOMONAS AERUGINOSA PAO1
    Organism Taxid208964

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
1EDO1Ligand/Ion1,2-ETHANEDIOL
2PO41Ligand/IonPHOSPHATE ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:329 , VAL A:331 , GLU A:350 , ALA A:428 , SER A:429 , THR A:442 , HOH A:2034 , HOH A:2177BINDING SITE FOR RESIDUE EDO A1447
2AC2SOFTWARESER A:344 , ALA A:345 , SER A:346 , ARG A:384 , TYR A:385 , HOH A:2097 , HOH A:2181BINDING SITE FOR RESIDUE PO4 A1448

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4B62)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4B62)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4B62)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4B62)

(-) Exons   (0, 0)

(no "Exon" information available for 4B62)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:143
 aligned with Q9I754_PSEAE | Q9I754 from UniProtKB/TrEMBL  Length:449

    Alignment length:143
                                   313       323       333       343       353       363       373       383       393       403       413       423       433       443   
         Q9I754_PSEAE   304 ERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAE 446
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhh...eeee...eeeeeee.hhh........hhhhhhhhhhhhhhhhhh...eeeeee............hhhhhhhhhhhhhhhhhhhhhh....eeeee...........hhhhhhhhheeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4b62 A 304 ERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAE 446
                                   313       323       333       343       353       363       373       383       393       403       413       423       433       443   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4B62)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4B62)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4B62)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q9I754_PSEAE | Q9I754)
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4b62)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4b62
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9I754_PSEAE | Q9I754
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9I754_PSEAE | Q9I754
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4B62)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4B62)