Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF FAD-CONTAINING FERREDOXIN-NADP REDUCTASE FROM XANTHOMONAS AXONOPODIS PV. CITRI
 
Authors :  M. Martinez-Julvez, E. G. Orellano, M. L. Tondo, R. Hurtado-Guerrero, E. A. Ceccarelli, A. Sanchez-Azqueta
Date :  30 Jul 12  (Deposition) - 21 Aug 13  (Release) - 11 Sep 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. L. Tondo, R. Hurtado-Guerrero, A. Sanchez-Azqueta, E. A. Ceccarelli, M. Medina, E. G. Orellano, M. Martinez-Julvez
Crystal Structure Of Fad-Containing Ferredoxin- Nadp Reductase From Xanthomonas Axonopodis Pv. Citri
Biomed Res Int V. 2013 06572 2013
PubMed-ID: 23984418  |  Reference-DOI: 10.1155/2013/906572

(-) Compounds

Molecule 1 - FERREDOXIN-NADP REDUCTASE
    Chains: A
    EC Number: 1.18.1.2
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Variant: PLYS
    Expression System Vector: PET28
    Expression System Vector Type: PLASMID
    Organism Scientific: XANTHOMONAS AXONOPODIS PV. CITRI STR. 306
    Organism Taxid: 190486

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric Unit (2, 2)
No.NameCountTypeFull Name
1CL1Ligand/IonCHLORIDE ION
2FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:52 , ALA A:53 , TYR A:54 , SER A:55 , PHE A:68 , SER A:69 , ILE A:70 , VAL A:72 , GLY A:75 , PRO A:76 , LEU A:77 , THR A:78 , THR A:118 , ARG A:243 , ARG A:254 , ALA A:255 , PHE A:256 , VAL A:257 , GLU A:258 , LYS A:259 , HOH A:2060 , HOH A:2061 , HOH A:2120 , HOH A:2121 , HOH A:2187 , HOH A:2221 , HOH A:2233 , HOH A:2235 , HOH A:2237 , HOH A:2238BINDING SITE FOR RESIDUE FAD A1260
2AC2SOFTWAREARG A:191 , LEU A:192 , THR A:193 , MET A:225 , HOH A:2180 , HOH A:2182BINDING SITE FOR RESIDUE CL A1261

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4B4D)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4B4D)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4B4D)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4B4D)

(-) Exons   (0, 0)

(no "Exon" information available for 4B4D)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:256
 aligned with Q8PMH0_XANAC | Q8PMH0 from UniProtKB/TrEMBL  Length:259

    Alignment length:256
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253      
         Q8PMH0_XANAC     4 AFGAETVLEVRHWTDAYFSFTTTRDAGFRFENGQFVMIGLETETRPLLRAYSIASANWEEHLEFFSIKVPDGPLTSRLQHIQPGDKVLVGKKPTGTLLISDLHPGRNLYLLGTGTGLAPWLSIIKDPETYERFDKVILTQGVRFVQDLAYRDYFERELPQHEFLGDLLREKLLYYPAVTRETFANQGRLTELMADGRMQQTLGLPTLDPANDRFMICGSPQMLADLRSLLDSRGFQTSPRIGTPGHYVFERAFVEK 259
               SCOP domains d4b4da1 A:4-101 automated matches                                                                 d4b4da2 A:102-259 automated matches                                                                                                                            SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeee....eeeeee............eeeeee......eeeeee.........eeeeee......hhhhhh......eeee........hhhh.....eeeeee.hhhhhhhhhhh.hhhhhhhh.eeeeeeee.hhhhhhhhhhhhhhhhhh..hhhhhhhheeeeeee.........hhhhhhhhhhhhhhhh........eeeeeeehhhhhhhhhhhhhhh.............eeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4b4d A   4 AFGAETVLEVRHWTDAYFSFTTTRDAGFRFENGQFVMIGLETETRPLLRAYSIASANWEEHLEFFSIKVPDGPLTSRLQHIQPGDKVLVGKKPTGTLLISDLHPGRNLYLLGTGTGLAPWLSIIKDPETYERFDKVILTQGVRFVQDLAYRDYFERELPQHEFLGDLLREKLLYYPAVTRETFANQGRLTELMADGRMQQTLGLPTLDPANDRFMICGSPQMLADLRSLLDSRGFQTSPRIGTPGHYVFERAFVEK 259
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit
(-)
Class: All beta proteins (24004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4B4D)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4B4D)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q8PMH0_XANAC | Q8PMH0)
molecular function
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4b4d)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4b4d
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8PMH0_XANAC | Q8PMH0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.18.1.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8PMH0_XANAC | Q8PMH0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4B4D)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4B4D)