|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 7)| Asymmetric Unit (2, 7) Biological Unit 1 (2, 14) |
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (1, 1)
Asymmetric Unit
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 4AX2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 4AX2) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 4AX2) |
Exons (0, 0)| (no "Exon" information available for 4AX2) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:124 aligned with K4DIE5_SERMA | K4DIE5 from UniProtKB/TrEMBL Length:125 Alignment length:128 1 | 7 17 27 37 47 57 67 77 87 97 107 117 K4DIE5_SERMA - ---MAPIQDPVAFIKQMPYHQVVKELALSRCLAQVSDSDKAFSLDAARTANAMREWMPFDIESGDEKINVLIDKYKSRINEFHSETKDKSQGVTLNCLRLYHSPELDKLSRQLIAGNPDRTWNQDNAK 125 SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript 4ax2 A 24 QGHMAPIQDPVAFIKQMPYHQVVKELALSRCLAQVSDSDKAFSLDAARTANAMREWMPFDIESGDEKINVLIDKYKSRINEFHS----KSQGVTLNCLRLYHSPELDKLSRQLIAGNPDRTWNQDNAK 151 33 43 53 63 73 83 93 103 | 113 123 133 143 107 112
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 4AX2) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 4AX2) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 4AX2) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 4AX2)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|