|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (5, 6)| Asymmetric/Biological Unit (5, 6) |
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 4AVD) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 4AVD) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 4AVD) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 4AVD) |
Exons (0, 0)| (no "Exon" information available for 4AVD) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:110 aligned with GLBN_CERLA | O76242 from UniProtKB/Swiss-Prot Length:110 Alignment length:110 10 20 30 40 50 60 70 80 90 100 110 GLBN_CERLA 1 MVNWAAVVDDFYQELFKAHPEYQNKFGFKGVALGSLKGNAAYKTQAGKTVDYINAAIGGSADAAGLASRHKGRNVGSAEFHNAKACLAKACSAHGAPDLGHAIDDILSHL 110 SCOP domains d4avda_ A: Nerve tissue mini-hemoglobin (neural globin) SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 4avd A 0 MVNWAAVVDDFYQELFKAHPEYQNKFGFKGVALGSLKGNAAYKTQAGKTVDYINAAIGGSADAAGLASRHKGRNVGSAEFHNAKACLAKACSAHGAPDLGHAIDDILSHL 109 9 19 29 39 49 59 69 79 89 99 109
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 4AVD) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 4AVD) |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (GLBN_CERLA | O76242)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|