|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (2, 4) Biological Unit 2 (0, 0) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (10, 10)
Asymmetric Unit
|
||||||||||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 4AEA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 4AEA) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 4AEA) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:68 aligned with 3L21_NAJKA | P01391 from UniProtKB/Swiss-Prot Length:71 Alignment length:69 10 20 30 40 50 60 3L21_NAJKA 1 IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRK 69 SCOP domains d4aeaa_ A: alpha-Cobratoxin SCOP domains CATH domains --------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------SNAKE_TOXIN --------- PROSITE Transcript --------------------------------------------------------------------- Transcript 4aea A 1 IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPT-G 1068 10 20 30 40 50 60 | | 67 | 1068 Chain B from PDB Type:PROTEIN Length:67 aligned with 3L21_NAJKA | P01391 from UniProtKB/Swiss-Prot Length:71 Alignment length:67 10 20 30 40 50 60 3L21_NAJKA 1 IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPT 67 SCOP domains d4aeab_ B: alpha-Cobratoxin SCOP domains CATH domains ------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------SNAKE_TOXIN ------- PROSITE Transcript ------------------------------------------------------------------- Transcript 4aea B 1 IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPT 67 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 4AEA) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 4AEA) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A,B (3L21_NAJKA | P01391)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|