Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF KEAP1 IN COMPLEX WITH A SMALL CHEMICAL COMPOUND, K67
 
Authors :  T. Fukutomi, T. Iso, T. Suzuki, K. Takagi, T. Mizushima, M. Komatsu, M. Y
Date :  21 May 15  (Deposition) - 25 May 16  (Release) - 13 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Nrf2, Keap1, Stress Sensor, Small Molecule Binding, Double Glycine Repeat, Kelch Domain, P62, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Saito, Y. Ichimura, K. Taguchi, T. Suzuki, T. Mizushima, K. Takagi, Y. Hirose, M. Nagahashi, T. Iso, T. Fukutomi, M. Ohishi, K. Endo, T. Uemura, Y. Nishito, S. Okuda, M. Obata, T. Kouno, R. Imamura, Y. Tada R. Obata, D. Yasuda, K. Takahashi, T. Fujimura, J. Pi, M. S. Lee, T. Ueno T. Ohe, T. Mashino, T. Wakai, H. Kojima, T. Okabe, T. Nagano, H. Motohashi, S. Waguri, T. Soga, M. Yamamoto, K. Tanaka, M. Komatsu
P62/Sqstm1 Promotes Malignancy Of Hcv-Positive Hepatocellular Carcinoma Through Nrf2-Dependent Metabolic Reprogramming
Nat Commun V. 7 12030 2016
PubMed-ID: 27345495  |  Reference-DOI: 10.1038/NCOMMS12030

(-) Compounds

Molecule 1 - KELCH-LIKE ECH-ASSOCIATED PROTEIN 1
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL 21 GOLD(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 321-609
    GeneKEAP1, INRF2, KIAA0132
    Organism CommonMOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    SynonymCYTOSOLIC INHIBITOR OF NRF2,INRF2

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric Unit (2, 4)
No.NameCountTypeFull Name
1FMT2Ligand/IonFORMIC ACID
2K672Ligand/IonN,N'-[2-(2-OXOPROPYL)NAPHTHALENE-1,4-DIYL]BIS(4-ETHOXYBENZENESULFONAMIDE)
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1FMT1Ligand/IonFORMIC ACID
2K671Ligand/IonN,N'-[2-(2-OXOPROPYL)NAPHTHALENE-1,4-DIYL]BIS(4-ETHOXYBENZENESULFONAMIDE)
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1FMT1Ligand/IonFORMIC ACID
2K671Ligand/IonN,N'-[2-(2-OXOPROPYL)NAPHTHALENE-1,4-DIYL]BIS(4-ETHOXYBENZENESULFONAMIDE)

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:491 , PRO A:492 , GLU A:493 , ARG A:494 , HOH A:836binding site for residue FMT A 701
2AC2SOFTWARETYR A:334 , SER A:363 , ARG A:415 , ARG A:483 , SER A:508 , GLY A:509 , TYR A:525 , SER A:555 , TYR A:572 , PHE A:577 , SER A:602 , GLY A:603 , HOH A:835 , HOH A:896binding site for residue K67 A 702
3AC3SOFTWARETYR B:491 , PRO B:492 , GLU B:493 , ARG B:494 , HOH B:811binding site for residue FMT B 701
4AC4SOFTWARETYR B:334 , SER B:363 , ARG B:415 , ARG B:483 , SER B:508 , GLY B:509 , TYR B:525 , SER B:555 , ALA B:556 , TYR B:572 , PHE B:577 , SER B:602 , GLY B:603binding site for residue K67 B 702

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:434 -A:434
2B:434 -B:434

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4ZY3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZY3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZY3)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZY3)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:285
                                                                                                                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..........eeee......eee...........eeeee..eeeee..eeee..eeee...eeeee....eeee...........eeeee..eeeee..ee..ee...eeeee....eeee...........eeeee..eeeeeeee....eeeeeeeee....eeee...........eeeee..eeeee...........eeeee....eeee...........eeeee..eeeee..........eeeeee....eeeeeee........eeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zy3 A 325 GRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGHIYAVGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMTSGRSGVGVAVT 609
                                   334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604     

Chain B from PDB  Type:PROTEIN  Length:285
                                                                                                                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..........eeee......eeee..........eeeee..eeeee..eeee..eeee...eeeee....eeeee..........eeeee..eeeee..ee..ee...eeee......eee...........eeeee..eeeee...........eeeee....eeee...........eeeee..eeeee...........eeeee....eeeee..........eeeee..eeeee..........eeeeee....eeeeeee........eeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zy3 B 325 GRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGHIYAVGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMTSGRSGVGVAVT 609
                                   334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZY3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZY3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZY3)

(-) Gene Ontology  (34, 34)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K67  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4zy3)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zy3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KEAP1_MOUSE | Q9Z2X8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KEAP1_MOUSE | Q9Z2X8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KEAP1_MOUSE | Q9Z2X81x2j 1x2r 2dyh 2z32 3ade 3wdz 3wn7 5cgj 5fnq 5fnr 5fns 5fnt 5fnu 5fzj 5fzn

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4ZY3)