Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ACETYLPOLYAMINE AMIDOHYDROLASE FROM MYCOPLANA RAMOSA IN COMPLEX WITH A HYDROXAMATE INHIBITOR
 
Authors :  C. Decroos, D. W. Christianson
Date :  17 May 15  (Deposition) - 29 Jul 15  (Release) - 12 Aug 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.13
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Acetylpolyamine Amidohydrolase, Arginase Fold, Enzyme-Inhibitor Complex, Polyamine, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Decroos, D. W. Christianson
Design, Synthesis, And Evaluation Of Polyamine Deacetylase Inhibitors, And High-Resolution Crystal Structures Of Their Complexes With Acetylpolyamine Amidohydrolase.
Biochemistry V. 54 4692 2015
PubMed-ID: 26200446  |  Reference-DOI: 10.1021/ACS.BIOCHEM.5B00536

(-) Compounds

Molecule 1 - ACETYLPOLYAMINE AMINOHYDROLASE
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-21B
    Expression System StrainBL21 (DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneAPHA, APH
    Organism ScientificMYCOPLANA RAMOSA
    Organism Taxid40837

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 11)

Asymmetric/Biological Unit (5, 11)
No.NameCountTypeFull Name
17XA2Ligand/Ion7-AMINO-N-HYDROXYHEPTANAMIDE
2GOL3Ligand/IonGLYCEROL
3K2Ligand/IonPOTASSIUM ION
4NH42Ligand/IonAMMONIUM ION
5ZN2Ligand/IonZINC ION

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:195 , HIS A:197 , ASP A:284 , 7XA A:404 , HOH A:512 , HOH A:524binding site for residue ZN A 401
02AC2SOFTWAREASP A:193 , ASP A:195 , HIS A:197 , SER A:216 , LEU A:217binding site for residue K A 402
03AC3SOFTWAREPHE A:206 , ARG A:209 , VAL A:212 , THR A:243 , HOH A:618binding site for residue NH4 A 403
04AC4SOFTWAREHIS A:158 , HIS A:159 , GLY A:167 , TYR A:168 , ASP A:195 , HIS A:197 , ASP A:284 , TYR A:323 , ZN A:401 , HOH A:512 , HOH A:524 , HOH A:604 , HOH A:766 , HOH A:812 , GLU B:106binding site for residue 7XA A 404
05AC5SOFTWARELYS A:15 , LYS A:84 , GLY A:85 , HOH A:546 , HOH A:628binding site for residue GOL A 405
06AC6SOFTWAREASP B:195 , HIS B:197 , ASP B:284 , 7XA B:404 , HOH B:526 , HOH B:527binding site for residue ZN B 401
07AC7SOFTWAREASP B:193 , ASP B:195 , HIS B:197 , SER B:216 , LEU B:217binding site for residue K B 402
08AC8SOFTWAREPHE B:206 , ARG B:209 , VAL B:212 , THR B:243 , HOH B:607binding site for residue NH4 B 403
09AC9SOFTWARETHR A:90 , HIS B:158 , HIS B:159 , GLY B:167 , ASP B:195 , HIS B:197 , ASP B:284 , TYR B:323 , ZN B:401 , HOH B:526 , HOH B:527 , HOH B:533 , HOH B:575 , HOH B:790binding site for residue 7XA B 404
10AD1SOFTWARELYS B:15 , TRP B:75 , LYS B:84 , GLY B:85 , HOH B:520 , HOH B:532binding site for residue GOL B 405
11AD2SOFTWAREHOH A:536 , HOH A:556 , ARG B:96 , THR B:97 , HOH B:501 , HOH B:807 , HOH B:808binding site for residue GOL B 406

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4ZUR)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Arg A:154 -Pro A:155
2Phe A:225 -Pro A:226
3Arg B:154 -Pro B:155
4Phe B:225 -Pro B:226

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZUR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZUR)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZUR)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:341
                                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhhhhhh....eee..eee.....hhhhhhhhhhhhhh...eee........hhhhh.hhhhhhhhhhhhhhhhhh......................hhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh...eeee....................hhhhhhhhhhhhh....eeeee.....hhhhhhhhh....eeeeeeee.................hhhhh..eeeeee....hhhhhhhhhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhh....eeeee......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zur A   1 MRVIFSEDHKLRNAKTELYGGELVPPFEAPFRAEWILAAVKEAGFDDVVAPARHGLETVLKVHDAGYLNFLETAWDRWKAAGYKGEAIATSFPVRRTSPRIPTDIEGQIGYYCNAAETAISPGTWEAALSSMASAIDGADLIAAGHKAAFSLCRPPGHHAGIDMFGGYCFINNAAVAAQRLLDKGAKKIAILDVDFHHGNGTQDIFYERGDVFFASLHGDPAEAFPHFLGYAEETGKGAGAGTTANYPMGRGTPYSVWGEALTDSLKRIAAFGAEAIVVSLGVDTFEQDPISFFKLTSPDYITMGRTIAASGVPLLVVMEGGYGVPEIGLNVANVLKGVAG 341
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340 

Chain B from PDB  Type:PROTEIN  Length:341
                                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee.hhhhhhh....eee..eee.....hhhhhhhhhhhhhh....ee........hhhhh.hhhhhhhhhhhhhhhhhh......................hhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh...eeee....................hhhhhhhhhhhhh....eeeee.....hhhhhhhhh....eeeeeeee.................hhhhh..eeeeee....hhhhhhhhhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhh....eeeee......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zur B   1 MRVIFSEDHKLRNAKTELYGGELVPPFEAPFRAEWILAAVKEAGFDDVVAPARHGLETVLKVHDAGYLNFLETAWDRWKAAGYKGEAIATSFPVRRTSPRIPTDIEGQIGYYCNAAETAISPGTWEAALSSMASAIDGADLIAAGHKAAFSLCRPPGHHAGIDMFGGYCFINNAAVAAQRLLDKGAKKIAILDVDFHHGNGTQDIFYERGDVFFASLHGDPAEAFPHFLGYAEETGKGAGAGTTANYPMGRGTPYSVWGEALTDSLKRIAAFGAEAIVVSLGVDTFEQDPISFFKLTSPDYITMGRTIAASGVPLLVVMEGGYGVPEIGLNVANVLKGVAG 341
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZUR)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZUR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZUR)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    7XA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NH4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg A:154 - Pro A:155   [ RasMol ]  
    Arg B:154 - Pro B:155   [ RasMol ]  
    Phe A:225 - Pro A:226   [ RasMol ]  
    Phe B:225 - Pro B:226   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zur
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  APAH_MYCRA | Q48935
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  APAH_MYCRA | Q48935
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        APAH_MYCRA | Q489353q9b 3q9c 3q9e 3q9f 4zum 4zun 4zuo 4zup 4zuq

(-) Related Entries Specified in the PDB File

4zum 4zun 4zuo 4zup 4zuq