Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF UNBOUND MERS-COV SPIKE RECEPTOR-BINDING DOMAIN (ENGLAND1 STRAIN).
 
Authors :  M. G. Joyce, J. R. Mascola, B. S. Graham, P. D. Kwong
Date :  08 May 15  (Deposition) - 12 Aug 15  (Release) - 12 Aug 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.02
Chains :  Asym. Unit :  R,S
Biol. Unit 1:  R  (1x)
Biol. Unit 2:  S  (1x)
Keywords :  Vaccine, Immunogen, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Wang, W. Shi, M. G. Joyce, K. Modjarrad, Y. Zhang, K. Leung, C. R. Lees T. Zhou, H. M. Yassine, M. Kanekiyo, Z. Y. Yang, X. Chen, M. M. Becker, M. Freeman, L. Vogel, J. C. Johnson, G. Olinger, J. P. Todd, U. Bagci, J. Solomon, D. J. Mollura, L. Hensley, P. Jahrling, M. R. Denison, S. S. Rao, K. Subbarao, P. D. Kwong, J. R. Mascola, W. P. Kong, B. S. Graha
Evaluation Of Candidate Vaccine Approaches For Mers-Cov.
Nat Commun V. 6 7712 2015
PubMed-ID: 26218507  |  Reference-DOI: 10.1038/NCOMMS8712

(-) Compounds

Molecule 1 - SPIKE GLYCOPROTEIN
    ChainsR, S
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293
    Expression System PlasmidCMVR
    Expression System Taxid9606
    Expression System Vector TypePLASMID
    FragmentRECEPTOR-BINDING DOMAIN, UNP RESIDUES 381-588
    GeneS, 3
    Organism CommonHCOV-EMC
    Organism ScientificHUMAN CORONAVIRUS EMC (ISOLATE UNITED KINGDOM/H123990006/2012)
    Organism Taxid1263720
    StrainISOLATE UNITED KINGDOM/H123990006/2012
    SynonymS GLYCOPROTEIN,E2,PEPLOMER PROTEIN

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit RS
Biological Unit 1 (1x)R 
Biological Unit 2 (1x) S

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric Unit (2, 5)
No.NameCountTypeFull Name
1NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE
2PO41Ligand/IonPHOSPHATE ION
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
2PO4-1Ligand/IonPHOSPHATE ION
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
1NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
2PO41Ligand/IonPHOSPHATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR S:424 , SER S:426 , GLN S:471 , THR S:477 , CYS S:478 , LEU S:479binding site for residue PO4 S 601
2AC2SOFTWAREASN R:410 , LYS R:413 , LYS R:587 , LEU R:588binding site for Mono-Saccharide NAG R 602 bound to ASN R 410
3AC3SOFTWAREASN R:487binding site for Mono-Saccharide NAG R 601 bound to ASN R 487
4AC4SOFTWAREASN S:410 , THR S:412 , LYS S:413 , LYS S:587binding site for Mono-Saccharide NAG S 603 bound to ASN S 410
5AC5SOFTWARESER S:416 , HIS S:486 , ASN S:487binding site for Mono-Saccharide NAG S 602 bound to ASN S 487

(-) SS Bonds  (8, 8)

Asymmetric Unit
No.Residues
1R:383 -R:407
2R:425 -R:478
3R:437 -R:585
4R:503 -R:526
5S:383 -S:407
6S:425 -S:478
7S:437 -S:585
8S:503 -S:526

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Ala S:461 -Gly S:462

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZPW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZPW)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZPW)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain R from PDB  Type:PROTEIN  Length:208
                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhh.....hhhhheeeee...eehhhhhhh..eeeeeeee.............eeeeeeee.hhhhhhhhh....hhhhhhh........eeeeeee............eeeeeeeeeee......eee........hhhhhh..........eeeee........eeeeeeeeee.....eeeeeeeee........ee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zpw R 381 VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL 588
                                   390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580        

Chain S from PDB  Type:PROTEIN  Length:208
                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhh.....hhhhheeeee...eehhhhhhh..eeeeeeee.............eeeeeeee.hhhhhhhhhhhhhhhhhhhh........eeeeeee............eeeeeeeeeeee.....eee........hhhhhh..........eeeeee......eeeeeeeeeee.....eeeeeeeee........ee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zpw S 381 VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL 588
                                   390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZPW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZPW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZPW)

(-) Gene Ontology  (15, 15)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala S:461 - Gly S:462   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zpw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SPIKE_CVEMC | K9N5Q8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SPIKE_CVEMC | K9N5Q8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SPIKE_CVEMC | K9N5Q84l72 4xak 4zpt 4zpv

(-) Related Entries Specified in the PDB File

4zpt 4zpv