Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF NOTCH3 NEGATIVE REGULATORY REGION
 
Authors :  X. Xu, S. C. Blacklow
Date :  01 May 15  (Deposition) - 19 Aug 15  (Release) - 19 Aug 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.48
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Notch, Mutation, Disease, Autoinhibiton, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  X. Xu, S. H. Choi, T. Hu, K. Tiyanont, R. Habets, A. J. Groot, M. Vooijs, J. C. Aster, R. Chopra, C. Fryer, S. C. Blacklow
Insights Into Autoregulation Of Notch3 From Structural And Functional Studies Of Its Negative Regulatory Region.
Structure V. 23 1227 2015
PubMed-ID: 26051713  |  Reference-DOI: 10.1016/J.STR.2015.05.001

(-) Compounds

Molecule 1 - NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 3
    Chains: A, B
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Cell Line: HEK293S GNTI-
    Expression System Taxid: 9606
    Gene: NOTCH3
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: NOTCH 3

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 16)

Asymmetric/Biological Unit (5, 16)
No.NameCountTypeFull Name
1ACT2Ligand/IonACETATE ION
2CA6Ligand/IonCALCIUM ION
3GOL3Ligand/IonGLYCEROL
4MAN2Ligand/IonALPHA-D-MANNOSE
5NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (13, 13)

Asymmetric Unit (13, 13)
No.NameEvidenceResiduesDescription
01AC1SOFTWARELYS A:1395 , ASP A:1398 , ARG A:1400 , ASP A:1402 , ASP A:1413 , ASP A:1416binding site for residue CA A 5001
02AC2SOFTWARELEU A:1436 , ASN A:1439 , ARG A:1441 , ASP A:1443 , ASP A:1454 , ASP A:1457binding site for residue CA A 5002
03AC3SOFTWAREHIS A:1478 , ASP A:1481 , ARG A:1483 , ASP A:1485 , ASP A:1496 , ASP A:1499binding site for residue CA A 5003
04AC4SOFTWARECYS A:1591 , LEU A:1592 , GLN A:1593 , SER A:1594 , ASN A:1597 , HOH A:5120binding site for residue GOL A 5008
05AC5SOFTWAREASN A:1455 , ARG A:1465 , ARG A:1619 , ASP A:1621 , HOH A:5131binding site for residue GOL A 5009
06AC6SOFTWAREASP A:1603 , ALA A:1604 , GLN A:1605 , GLY A:1631 , GLU A:1632binding site for residue ACT A 5010
07AC7SOFTWAREGLU A:1491 , ARG A:1540 , HIS A:1599binding site for residue ACT A 5011
08AC8SOFTWAREASP B:1398 , ARG B:1400 , ASP B:1402 , ASP B:1413 , ASP B:1416binding site for residue CA B 5001
09AC9SOFTWARELEU B:1436 , ASN B:1439 , ARG B:1441 , ASP B:1443 , ASP B:1454 , ASP B:1457binding site for residue CA B 5002
10AD1SOFTWAREHIS B:1478 , ASP B:1481 , ARG B:1483 , ASP B:1485 , ASP B:1496 , ASP B:1499binding site for residue CA B 5003
11AD2SOFTWAREASN B:1489 , CYS B:1500 , ALA B:1501 , LEU B:1590 , HOH B:5106binding site for residue GOL B 5005
12AD3SOFTWAREASN A:1438 , GLN A:1593 , VAL A:1617 , GLU A:1618 , ARG A:1619 , HOH A:5102 , HOH A:5104 , HOH A:5105 , HOH A:5127binding site for Poly-Saccharide residues NAG A 5004 through MAN A 5007 bound to ASN A 1438
13AD4SOFTWAREASN B:1438 , VAL B:1617binding site for Mono-Saccharide NAG B 5004 bound to ASN B 1438

(-) SS Bonds  (19, 19)

Asymmetric/Biological Unit
No.Residues
1A:1387 -A:1410
2A:1392 -A:1405
3A:1401 -A:1417
4A:1428 -A:1451
5A:1433 -A:1446
6A:1442 -A:1458
7A:1467 -A:1493
8A:1475 -A:1488
9A:1484 -A:1500
10A:1591 -A:1600
11B:1392 -B:1405
12B:1401 -B:1417
13B:1428 -B:1451
14B:1433 -B:1446
15B:1442 -B:1458
16B:1467 -B:1493
17B:1475 -B:1488
18B:1484 -B:1500
19B:1591 -B:1600

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4ZLP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZLP)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZLP)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZLP)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:241
                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhh.....hhhhhhhhhhhhhh................hhhhhh.....hhhhhhhhhhhhhhh...hhhhh..hhhhhhhhhhhh.....hhhhh....hhhhhh............eeeeee..hhhhhhhhhhhhhhhhhhhhh.eeee.........eeeee.....eeeeeeeeeee...............hhhhhhhhhhhhhhh........eeeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4zlp A 1385 PRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPP 1637
                                  1394      1404      1414      1424      1434      1444      1454      1464      1474      1484      1494      1504      1514      1524      1534      1544      1554      1576      1586      1596      1606      1616      1626      1636 
                                                                                                                                                                                                          1562|                                                              
                                                                                                                                                                                                           1575                                                              


Chain B from PDB  Type:PROTEIN  Length:218
                                                                                                                                                                                                                                                           
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhh...............hhhhh......hhhhhhhhhhhhhhh....hhhhh....hhhhhhhhh.....hhhhh....hhhhhh............eeeeee..hhhhhhhhhhhhhhhhhhhhh.eeee.........eeee.....eeeeeeeee..........hhhhhhhhhhhhhhh........eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4zlp B 1392 CGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHREVIGSVVMLEIDNRLCLDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEP 1633
                            ||    1405      1415      1425      1435      1445      1455      1465      1475      1485      1495      1505      1515      1525      1535      1545      1555    ||1580      1590 ||   1605      1615      1625        
                         1392|                                                                                                                                                               1560|            1592|                                   
                          1397                                                                                                                                                                1576             1598
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZLP)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZLP)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZLP)

(-) Gene Ontology  (32, 32)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4zlp)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zlp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NOTC3_HUMAN | Q9UM47
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  NOTC3_HUMAN | Q9UM47
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NOTC3_HUMAN | Q9UM47: 5czv 5czx

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4ZLP)