Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STREPTOMYCES BINGCHENGGENSIS IN NON-COVALENT COMPLEX WITH POSTASSIUM FORMATE
 
Authors :  L. S. Mueller, N. R. Silvaggi
Date :  15 Apr 15  (Deposition) - 17 Jun 15  (Release) - 15 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.40
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Aldolase, Dehydratase, Acetoacetate Decarboxylase, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. S. Mueller, R. W. Hoppe, J. M. Ochsenwald, R. T. Berndt, G. B. Severin A. W. Schwabacher, N. R. Silvaggi
Sbi00515, A Protein Of Unknown Function From Streptomyces Bingchenggensis, Highlights The Functional Versatility Of The Acetoacetate Decarboxylase Scaffold.
Biochemistry V. 54 3978 2015
PubMed-ID: 26039798  |  Reference-DOI: 10.1021/ACS.BIOCHEM.5B00483

(-) Compounds

Molecule 1 - ACETOACETATE DECARBOXYLASE
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PE-SUMOKAN
    Expression System Strain: BL21STAR(DE3)
    Expression System Taxid: 469008
    Gene: SBI_00515
    Organism Scientific: STREPTOMYCES BINGCHENGGENSIS (STRAIN BCW-1)
    Organism Taxid: 749414
    Strain: BCW-1

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 18)

Asymmetric/Biological Unit (4, 18)
No.NameCountTypeFull Name
1ETE1Ligand/Ion2-{2-[2-2-(METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL
2FMT11Ligand/IonFORMIC ACID
3PE41Ligand/Ion2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL
4PEG5Ligand/IonDI(HYDROXYETHYL)ETHER

(-) Sites  (18, 18)

Asymmetric Unit (18, 18)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETYR A:24 , TYR A:82 , ARG A:114 , GLN A:118 , LYS A:122binding site for residue FMT A 301
02AC2SOFTWARELYS A:164 , ILE A:165 , THR A:166 , THR A:221 , ALA A:222 , ASP A:223 , HOH A:551binding site for residue FMT A 302
03AC3SOFTWAREGLY A:137 , THR A:140 , HOH A:401 , HOH A:402 , HOH A:548 , HOH A:656 , TYR D:74binding site for residue FMT A 303
04AC4SOFTWAREHOH A:441 , LEU B:227binding site for residue PEG A 304
05AC5SOFTWARETHR A:70 , GLY A:71 , LEU A:72 , LEU A:75 , ASP A:76 , ARG A:241 , HOH A:408 , HOH A:598 , HOH A:715 , HIS C:230 , ALA D:163binding site for residue PE4 A 305
06AC6SOFTWARETYR B:24 , TYR B:82 , ARG B:114 , GLN B:118 , LYS B:122binding site for residue FMT B 301
07AC7SOFTWARELYS B:164 , ILE B:165 , THR B:166 , THR B:221 , ALA B:222 , HOH B:420binding site for residue FMT B 302
08AC8SOFTWAREHIS A:230 , GLU B:162 , ALA B:163 , LYS B:164 , HOH B:520 , HOH B:545 , HOH B:586 , HOH B:614 , LEU C:75 , ASP C:76binding site for residue ETE B 303
09AC9SOFTWAREPRO B:228 , HIS B:230 , HOH B:567binding site for residue PEG B 304
10AD1SOFTWARETYR C:24 , TYR C:82 , ALA C:111 , ARG C:114 , GLN C:118 , LYS C:122binding site for residue FMT C 301
11AD2SOFTWARELYS C:164 , ILE C:165 , THR C:166 , THR C:221 , ALA C:222 , ASP C:223 , HOH C:543 , HOH C:601binding site for residue FMT C 302
12AD3SOFTWAREHOH B:622 , ALA C:132 , SER C:134 , HOH C:423 , HOH C:447 , HOH C:486 , HOH C:509 , HOH C:579binding site for residue FMT C 303
13AD4SOFTWAREALA C:163 , HIS D:230binding site for residue PEG C 304
14AD5SOFTWAREHIS C:230 , HOH C:408 , HOH C:544 , HOH C:614 , LEU D:227binding site for residue PEG C 305
15AD6SOFTWAREHOH A:472 , GLY D:137 , PRO D:138 , THR D:140 , HOH D:1398binding site for residue FMT D 301
16AD7SOFTWARELYS D:164 , ILE D:165 , THR D:166 , THR D:221 , ALA D:222 , ASP D:223 , HOH D:1205binding site for residue FMT D 302
17AD8SOFTWARETYR D:24 , TYR D:82 , ALA D:111 , ARG D:114 , GLN D:118 , LYS D:122binding site for residue FMT D 303
18AD9SOFTWAREALA A:163 , HIS B:230 , LEU D:75 , ASP D:76 , HOH D:1406binding site for residue PEG D 304

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4ZBO)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1Val A:6 -Pro A:7
2Pro A:20 -Pro A:21
3Val B:6 -Pro B:7
4Pro B:20 -Pro B:21
5Val C:6 -Pro C:7
6Pro C:20 -Pro C:21
7Val D:6 -Pro D:7
8Pro D:20 -Pro D:21

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ZBO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ZBO)

(-) Exons   (0, 0)

(no "Exon" information available for 4ZBO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:263
                                                                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................eeeeeeeeeeeee.hhhhhhhh.....ee......eeeeeeeeeeee...hhhhhhhhheeeeeeeeeeeee..eeeeeeeeeee.hhhhhhhhhhhh..eee.eeee..................eeeeeeee..eeeeeeeeeeeee..hhhhh....eeeeeee............eeeeeee..eeeeeeeeeeeeeeeee......hhhhh...eeeeeeeeeeeeee..eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zbo A   1 MKGYTVPLSPRGIANLAPAPPWHYAGTVVGVEFFTDPAAAAATLPEGLTPDPDSAGRGVAMFIDWQYSSTGLEYLDPARSQYREFLITLDAHCNGAPVAWCPYIYVDNDAAMARGWVQGFPKKLGAVHQTRAYSVGGPGTPVLGPGGQFGATASSAGQRIAEAKITLEQPVPDPAALMSRPVINLRHFPRLAAGQHDQPAVHELVMSVLDDTAVSDAWVGTADLAFLPAHGEELADLPVRRTGKGFHFDLAYTVTDLMTLADH 263
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260   


Chain B from PDB  Type:PROTEIN  Length:260
                                                                                                                                                                                                                                                                                                    
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................eeeeeeeeeeeee.hhhhhhhh.....ee......eeeeeeeeeeee...hhhhhhhhheeeeeeeeeeeee..eeeeeeeeeee.hhhhhhhhhhhh..eee.eeee..................eeeeeeee..eeeeeeeeeeeee..hhhhhhh..eeeeeee............eeeeeee..eeeeeeeeeeeeeeeee......hhhhh...eeeeeeeeeeeeee..eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zbo B   1 MKGYTVPLSPRGIANLAPAPPWHYAGTVVGVEFFTDPAAAAATLPEGLTPDPDSAGRGVAMFIDWQYSSTGLEYLDPARSQYREFLITLDAHCNGAPVAWCPYIYVDNDAAMARGWVQGFPKKLGAVHQTRAYSVGGPGTPVLGPGGQFGATASSAGQRIAEAKITLEQPVPDPAALMSRPVINLRHFPRLAAGQHDQPAVHELVMSVLDDTAVSDAWVGTADLAFLPAHGEELADLPVRRTGKGFHFDLAYTVTDLMTL 260
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260


Chain C from PDB  Type:PROTEIN  Length:252
                                                                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....................eeeeeeeeeeeee.hhhhhhhh....eee......eeeeeeeeeeee...hhhhhhhhheeeeeeeeeeeee..eeeeeeeeeee.hhhhhhhhhhhh..eee.eeee..................eeeeeeee..eeeeeeeeeeeee...eeeeeee............eeeeeee..eeeeeeeeeeeeeeeee......hhhhh...eeeeeeeeeeeeee..eee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4zbo C   1 MKGYTVPLSPRGIANLAPAPPWHYAGTVVGVEFFTDPAAAAATLPEGLTPDPDSAGRGVAMFIDWQYSSTGLEYLDPARSQYREFLITLDAHCNGAPVAWCPYIYVDNDAAMARGWVQGFPKKLGAVHQTRAYSVGGPGTPVLGPGGQFGATASSAGQRIAEAKITLEQPVRPVINLRHFPRLAAGQHDQPAVHELVMSVLDDTAVSDAWVGTADLAFLPAHGEELADLPVRRTGKGFHFDLAYTVTDLMTL 260
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170||     188       198       208       218       228       238       248       258  
                                                                                                                                                                                                    171|                                                                                
                                                                                                                                                                                                     180                                                                                


Chain D from PDB  Type:PROTEIN  Length:260
                                                                                                                                                                                                                                                                                                    
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................eeeeeeeeeeeee.hhhhhhhh.....ee......eeeeeeeeeeee...hhhhhhhhheeeeeeeeeeeee..eeeeeeeeeee.hhhhhhhhhhhh..eee.eeee..................eeeeeeee..eeeeeeeeeeeee..hhhhhhh..eeeeeee............eeeeeee..eeeeeeeeeeeeeeeee......hhhhh...eeeeeeeeeeeeee..eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zbo D   1 MKGYTVPLSPRGIANLAPAPPWHYAGTVVGVEFFTDPAAAAATLPEGLTPDPDSAGRGVAMFIDWQYSSTGLEYLDPARSQYREFLITLDAHCNGAPVAWCPYIYVDNDAAMARGWVQGFPKKLGAVHQTRAYSVGGPGTPVLGPGGQFGATASSAGQRIAEAKITLEQPVPDPAALMSRPVINLRHFPRLAAGQHDQPAVHELVMSVLDDTAVSDAWVGTADLAFLPAHGEELADLPVRRTGKGFHFDLAYTVTDLMTL 260
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ZBO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ZBO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ZBO)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ETE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FMT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PE4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:20 - Pro A:21   [ RasMol ]  
    Pro B:20 - Pro B:21   [ RasMol ]  
    Pro C:20 - Pro C:21   [ RasMol ]  
    Pro D:20 - Pro D:21   [ RasMol ]  
    Val A:6 - Pro A:7   [ RasMol ]  
    Val B:6 - Pro B:7   [ RasMol ]  
    Val C:6 - Pro C:7   [ RasMol ]  
    Val D:6 - Pro D:7   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4zbo
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  D7C0E5_STRBB | D7C0E5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  D7C0E5_STRBB | D7C0E5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        D7C0E5_STRBB | D7C0E5: 4zbt

(-) Related Entries Specified in the PDB File

4zbt