Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  HYPOXANTHINE-GUANINE-XANTHINE PHOSPHORIBOSYLTRANSFERASE (HGXPRT) FROM SULFOLOBUS SOLFATARICUS IN COMPLEX WITH ALPHA-PHOSPHORIBOSYLPYROPHOSPHORIC ACID (PRPP) AND MAGNESIUM
 
Authors :  S. Christoffersen
Date :  27 Mar 15  (Deposition) - 29 Apr 15  (Release) - 29 Apr 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.15
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Transferase, Phosphoribosyltransferase, Hgxprt, Hgprt (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Christoffersen, M. R. Hansen, K. S. Jensen, S. Larsen, K. F. Jensen
Hypoxanthine-Guanine-Xanthine Phosphoribosyltransferase (Hgxprt) From Sulfolobus Solfataricus In Complex With Alpha-Phosphoribosylpyrophosphoric Acid (Prpp) And Magnesiu
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PHOSPHORIBOSYLTRANSFERASE
    Atcc: 35092
    Chains: A, B
    EC Number: 2.4.2.8
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PKU1
    Expression System Strain: NF1830
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: GPT-2
    Organism Scientific: SULFOLOBUS SOLFATARICUS (STRAIN ATCC 35092 / DSM 1617 / JCM 11322 / P2)
    Organism Taxid: 555311
    Strain: 98/2

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric Unit (2, 4)
No.NameCountTypeFull Name
1MG2Ligand/IonMAGNESIUM ION
2PRP2Ligand/IonALPHA-PHOSPHORIBOSYLPYROPHOSPHORIC ACID
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1MG-1Ligand/IonMAGNESIUM ION
2PRP4Ligand/IonALPHA-PHOSPHORIBOSYLPYROPHOSPHORIC ACID

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR A:38 , GLY A:39 , LYS A:62 , PHE A:63 , ARG A:65 , ASP A:93 , ASP A:94 , VAL A:95 , ASP A:97 , THR A:98 , GLY A:99 , THR A:101 , MG A:202 , HOH A:303 , HOH A:308 , HOH A:321 , HOH A:329 , HOH A:330 , HOH A:339 , HOH A:373 , HOH A:377 , HOH A:382binding site for residue PRP A 201
2AC2SOFTWAREPRP A:201 , HOH A:329 , HOH A:373binding site for residue MG A 202
3AC3SOFTWARELYS A:179 , HOH A:312 , HOH A:348 , LEU B:37 , THR B:38 , GLY B:39 , LYS B:62 , PHE B:63 , ASP B:93 , ASP B:94 , VAL B:95 , ASP B:97 , THR B:98 , GLY B:99 , GLU B:100 , THR B:101 , MG B:202 , HOH B:319 , HOH B:320 , HOH B:346 , HOH B:349 , HOH B:355 , HOH B:361 , HOH B:362 , HOH B:404 , HOH B:425binding site for residue PRP B 201
4AC4SOFTWAREPRP B:201 , HOH B:319 , HOH B:355binding site for residue MG B 202

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4Z1O)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Leu A:37 -Thr A:38
2Leu B:37 -Thr B:38

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4Z1O)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4Z1O)

(-) Exons   (0, 0)

(no "Exon" information available for 4Z1O)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:171
                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhh.....eeeeee..hhhhhhhhhhhhh...eeeeeee.......eeeeee.......eeeeeeeee..hhhhhhhhhhhhh....eeeeeeeee............ee.........hhhhhhhhh......hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z1o A   4 YHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFYRESKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIRK 179
                                    13        23        33        43        53        63 ||     78        88        98       108       118       128       138       148       158       168       178 
                                                                                        65|                                                                                                            
                                                                                         71                                                                                                            


Chain B from PDB  Type:PROTEIN  Length:176
                                                                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..hhhhhhhhhhhhhhhhhhh.....eeeeee..hhhhhhhhhhhhh...eeeeeee............eeeeee.......eeeeeeeee..hhhhhhhhhhhhh....eeeeeeeee.........eeeee...ee....hhhhhhhhh......hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z1o B   3 EYHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFYRSVGKTESKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIR 178
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4Z1O)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4Z1O)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4Z1O)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PRP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:37 - Thr A:38   [ RasMol ]  
    Leu B:37 - Thr B:38   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4z1o
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  D0KMY9_SULS9 | D0KMY9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.4.2.8
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  D0KMY9_SULS9 | D0KMY9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4Z1O)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4Z1O)