Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE ANALYSIS OF KELCH PROTEIN FROM PLASMODIUM FALCIPARUM
 
Authors :  D. Q. Jiang, W. Tempel, P. Loppnau, S. Graslund, H. He, M. Ravichandran, A. Seitova, C. H. Arrowsmith, A. M. Edwards, C. Bountra, M. El Bakkour G. Senisterra, K. T. Osman, D. V. Lovato, R. Hui, A. Hutchinson, Y. H. Li Structural Genomics Consortium (Sgc)
Date :  23 Mar 15  (Deposition) - 01 Apr 15  (Release) - 22 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.81
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Structural Genomics Consortium, Sgc, Putative Kelch Protein, K13, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Q. Jiang, W. Tempel, P. Loppnau, S. Graslund, H. He, M. Ravichandran A. Seitova, C. H. Arrowsmith, A. M. Edwards, C. Bountra, M. El Bakkouri, G. Senisterra, K. T. Osman, D. V. Lovato, R. Hui, A. Hutchinson, Y. H. Lin
Crystal Structure Analysis Of Kelch Protein From Plasmodium Falciparum.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - KELCH PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Common: FALL ARMYWORM
    Expression System Plasmid: PFBOH-MH
    Expression System Strain: SF9
    Expression System Taxid: 7108
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 338-726
    Gene: PF13_0238
    Organism Scientific: PLASMODIUM FALCIPARUM
    Organism Taxid: 5833

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 36)

Asymmetric Unit (2, 36)
No.NameCountTypeFull Name
1GOL6Ligand/IonGLYCEROL
2UNX30Ligand/IonUNKNOWN ATOM OR ION
Biological Unit 1 (2, 20)
No.NameCountTypeFull Name
1GOL2Ligand/IonGLYCEROL
2UNX18Ligand/IonUNKNOWN ATOM OR ION
Biological Unit 2 (2, 16)
No.NameCountTypeFull Name
1GOL4Ligand/IonGLYCEROL
2UNX12Ligand/IonUNKNOWN ATOM OR ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:513 , LEU A:514 , ASP A:516 , HOH A:973 , HOH A:987 , GLN B:467binding site for residue GOL A 819
2AC2SOFTWARESER A:466 , GLN A:467 , GLN A:468 , HOH A:941 , ARG B:513 , ASP B:516 , HOH B:981binding site for residue GOL A 820
3AC3SOFTWAREPHE B:451 , TYR B:456 , TYR B:482 , HOH B:903 , HOH B:1105binding site for residue GOL B 813
4AC4SOFTWARESER B:649 , HOH B:954 , HOH B:987binding site for residue GOL B 814
5AC5SOFTWARELYS B:479 , ASN B:499 , TYR B:500 , ASP B:501 , HOH B:967 , HOH B:1083binding site for residue GOL B 815
6AC6SOFTWAREARG B:529 , ASN B:530 , SER B:576 , SER B:577binding site for residue GOL B 816

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4YY8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4YY8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4YY8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4YY8)

(-) Exons   (0, 0)

(no "Exon" information available for 4YY8)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:373
                                                                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..eeeeeehhhhh....hhhhhhh..........eee..hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhh.......eeeee...........eeeee....eeee...........eeeee..eeeee............eeeee....eeee...........eeeee..eeeee...........eeeee....eeee...........eeeee..eeeee..........eeeee.hhheeee........ee..eeeee..eeeee..ee........eeeee....eeeee..........eeee...eeee..........eeee......eee...........eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yy8 A 350 TMIDINVGGAIFETSRHTLTQQKDSFIEKLLHHVTRDKQGRIFLDRDSELFRIILNFLRNPLTIPIPKDLSESEALLKEAEFYGIKFLPFPLVFCIGGFDGVEYLNSMELLDISQQCWRMCTPMSTKKAYFGSAVLNNFLYVFGGNNYDYKALFETEVYDRLRDVWYVSSNLNIPRRNNCGVTSNGRIYCIGGYDGSSIIPNVEAYDHRMKAWVEVAPLNTPRSSAMCVAFDNKIYVIGGTNGERLNSIEVYEEKMNKWEQFPYALLEARSSGAAFNYLNQIYVVGGIDNEHNILDSVEQYQPFNKRWQFLNGVPEKKMNFGAATLSSYIITGGENGEVLNSCHFFSPDTNEWQLGPSLLVPRFGHSVLIANI 726
                                   359       369       379||     392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672      |683       693       703       713       723   
                                                        380|                                                                                                                                                                                                                                                                                                    679|                                             
                                                         384                                                                                                                                                                                                                                                                                                     681                                             


Chain B from PDB  Type:PROTEIN  Length:377
                                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..eeeeeehhhhhh...hhhhhhhh............eee..hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhh.......eeeee...........eeeee....eeee...........eeeee..eeeee............eeeee....eeee...........eeeee..eeeee...........eeeee....eeeee..........eeeee..eeeee..........eeeee....eeee........ee..eeeee..eeeeeeeee....eeeeeeeee....eeeee..........eeeee..eeeee..........eeee......eee...........eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yy8 B 350 TMIDINVGGAIFETSRHTLTQQKDSFIEKLLSGRHHVTRDKQGRIFLDRDSELFRIILNFLRNPLTIPIPKDLSESEALLKEAEFYGIKFLPFPLVFCIGGFDGVEYLNSMELLDISQQCWRMCTPMSTKKAYFGSAVLNNFLYVFGGNNYDYKALFETEVYDRLRDVWYVSSNLNIPRRNNCGVTSNGRIYCIGGYDGSSIIPNVEAYDHRMKAWVEVAPLNTPRSSAMCVAFDNKIYVIGGTNGERLNSIEVYEEKMNKWEQFPYALLEARSSGAAFNYLNQIYVVGGIDNEHNILDSVEQYQPFNKRWQFLNGVPEKKMNFGAATLSDSYIITGGENGEVLNSCHFFSPDTNEWQLGPSLLVPRFGHSVLIANI 726
                                   359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639       649       659       669       679       689       699       709       719
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4YY8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4YY8)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4YY8)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4YY8)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UNX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4yy8)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4yy8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A077LQB4_P | A0A077LQB4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A0A077LQB4_P | A0A077LQB4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4YY8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4YY8)