Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF H. INFLUENZAE TRMD IN COMPLEX WITH SINEFUNGIN AND TRNA VARIANT (G36U)
 
Authors :  K. Yoshida, T. Ito, S. Yokoyama
Date :  20 Mar 15  (Deposition) - 15 Jul 15  (Release) - 09 Sep 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Mtase, Spout, Trna, Transferase-Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Ito, I. Masuda, K. Yoshida, S. Goto-Ito, S. Sekine, S. W. Suh, Y. M. Hou, S. Yokoyama
Structural Basis For Methyl-Donor-Dependent And Sequence-Specific Binding To Trna Substrates By Knotted Methyltransferase Trmd.
Proc. Natl. Acad. Sci. Usa V. 112 E4197 2015
PubMed-ID: 26183229  |  Reference-DOI: 10.1073/PNAS.1422981112

(-) Compounds

Molecule 1 - TRNA (GUANINE-N(1)-)-METHYLTRANSFERASE
    ChainsA, B
    EC Number2.1.1.228
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneTRMD, HI_0202
    Organism ScientificHAEMOPHILUS INFLUENZAE (STRAIN ATCC 51907 / DSM 11121 / KW20 / RD)
    Organism Taxid71421
    StrainATCC 51907 / DSM 11121 / KW20 / RD
    SynonymM1G-METHYLTRANSFERASE,TRNA [GM37] METHYLTRANSFERASE
 
Molecule 2 - TRNA
    ChainsC
    EngineeredYES
    Organism ScientificTHERMOTOGA MARITIMA MSB8
    Organism Taxid243274
    SyntheticYES

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1SFG2Ligand/IonSINEFUNGIN

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:86 , LEU A:87 , SER A:88 , PRO A:89 , GLN A:90 , GLY A:113 , TYR A:115 , GLU A:116 , SER A:132 , ILE A:133 , GLY A:134 , TYR A:136 , LEU A:138 , THR A:139 , GLY A:140 , GLY A:141 , PRO A:144 , ASP B:169 , SER B:170 , ASP B:177 , G C:37binding site for residue SFG A 301
2AC2SOFTWAREASP A:177 , HIS A:180 , TYR B:86 , LEU B:87 , SER B:88 , PRO B:89 , GLN B:90 , GLY B:113 , ARG B:114 , TYR B:115 , GLU B:116 , GLY B:117 , TRP B:131 , SER B:132 , ILE B:133 , GLY B:134 , TYR B:136 , LEU B:138 , GLY B:140 , GLY B:141 , PRO B:144binding site for residue SFG B 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4YVJ)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Arg A:183 -Pro A:184
2Arg B:183 -Pro B:184

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4YVJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4YVJ)

(-) Exons   (0, 0)

(no "Exon" information available for 4YVJ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:239
                                                                                                                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhhhhhhhh..eeeeeehhhhhh.......ee.........eehhhhhhhhhhhhhhhhh...eeeee....ee.hhhhhhhhhhh.eeeee.......hhhhhhhhh.eeee........hhhhhhhhhhhhhh......................ee..ee.hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yvj A  -1 SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS 246
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158||     177       187       197       207       217       227       237         
                                                                                                                                                                                          159|                                                                             
                                                                                                                                                                                           169                                                                             

Chain B from PDB  Type:PROTEIN  Length:249
                                                                                                                                                                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee..hhhhhhhhhhhhhhhhhhhh..eeeeeehhhhhh.......ee.........eehhhhhhhhhhhhhhhhh...eeeee....ee.hhhhhhhhh...eeeeee......hhhhhhhhh.eeee........hhhhhhhhhhhhhh........hhhhh..................ee..ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yvj B  -2 GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS 246
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237         

Chain C from PDB  Type:RNA  Length:71
                                                                                                       
                 4yvj C   1 UGGGAGGUCGUCUAACGGUAGGACGGCGGACUCUUGAUCCGCUGGUGGAGGUUCGAGUCCUCCCCUCCCAG  73
                                    10     || 21        31        41    ||  52        62        72 
                                          16|                          46|                         
                                           18                           48                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4YVJ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4YVJ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4YVJ)

(-) Gene Ontology  (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SFG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg A:183 - Pro A:184   [ RasMol ]  
    Arg B:183 - Pro B:184   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4yvj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TRMD_HAEIN | P43912
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.228
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TRMD_HAEIN | P43912
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TRMD_HAEIN | P439121uaj 1uak 1ual 1uam 3axz 4mcb 4mcc 4mcd 4ypw 4ypx 4ypy 4ypz 4yq0 4yq1 4yq2 4yq3 4yq4 4yq5 4yq6 4yq7 4yq8 4yq9 4yqa 4yqb 4yqc 4yqd 4yqg 4yqi 4yqj 4yqk 4yql 4yqn 4yqo 4yqp 4yqq 4yqr 4yqs 4yqt 4yvg 4yvh 4yvi 4yvk 5d9f

(-) Related Entries Specified in the PDB File

4yvg 4yvh 4yvi 4yvk