Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PIRATOXIN I (PRTX-I) COMPLEXED TO CAFFEIC ACID
 
Authors :  C. A. H. Fernandes, M. R. M. Fontes
Date :  18 Mar 15  (Deposition) - 05 Aug 15  (Release) - 30 Sep 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Phospholipase A2 Phospholipase A2-Like Bothrops Snake Venom Inhibitor, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. A. Fernandes, F. F. Cardoso, W. G. Cavalcante, A. M. Soares, M. Dal-Pai, M. Gallacci, M. R. Fontes
Structural Basis For The Inhibition Of A Phospholipase A2-Like Toxin By Caffeic And Aristolochic Acids.
Plos One V. 10 33370 2015
PubMed-ID: 26192963  |  Reference-DOI: 10.1371/JOURNAL.PONE.0133370
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BASIC PHOSPHOLIPASE A2 HOMOLOG PIRATOXIN-1
    Chains: B, A
    Organism Common: PIRAJA'S LANCE HEAD
    Organism Scientific: BOTHROPS PIRAJAI
    Organism Taxid: 113192
    Synonym: SVPLA2 HOMOLOG,MYOTOXIN SIV-SP5,PIRATOXIN-I,PRTX-I

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 8)

Asymmetric/Biological Unit (3, 8)
No.NameCountTypeFull Name
1DHC4Ligand/IonCAFFEIC ACID
2PE43Ligand/Ion2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL
3SO41Ligand/IonSULFATE ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPRO A:113 , GLY B:6 , PRO B:17 , TYR B:21binding site for residue PE4 B 201
2AC2SOFTWAREPHE B:3 , LYS B:7 , LEU B:10 , GLN B:11 , TYR B:66 , TRP B:68binding site for residue PE4 B 202
3AC3SOFTWARELEU A:111 , LYS B:15 , ASN B:16 , PRO B:80 , HOH B:307 , HOH B:314 , HOH B:357binding site for residue DHC B 203
4AC4SOFTWARELYS B:19 , THR B:55 , LYS B:105 , ARG B:108 , HOH B:307binding site for residue DHC B 204
5AC5SOFTWARELEU A:2 , GLY A:6 , PRO A:17 , TYR A:21 , HOH A:307binding site for residue PE4 A 201
6AC6SOFTWAREGLY A:32 , ARG A:33 , LYS A:52 , HOH A:343 , HOH A:346 , HOH A:364binding site for residue SO4 A 202
7AC7SOFTWARETHR A:72 , ILE A:94 , ARG A:97 , GLU A:98 , HOH A:303 , HOH A:309 , HOH A:359 , LYS B:35 , PRO B:36 , ARG B:42binding site for residue DHC A 203
8AC8SOFTWARELYS A:15 , LYS A:19 , LYS A:105 , ARG A:108 , HOH A:301 , HOH A:370 , THR B:55 , GLY B:56binding site for residue DHC A 204

(-) SS Bonds  (14, 14)

Asymmetric/Biological Unit
No.Residues
1A:26 -A:115
2A:28 -A:44
3A:43 -A:95
4A:49 -A:121
5A:50 -A:88
6A:57 -A:81
7A:75 -A:86
8B:26 -B:115
9B:28 -B:44
10B:43 -B:95
11B:49 -B:121
12B:50 -B:88
13B:57 -B:81
14B:75 -B:86

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4YU7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4YU7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4YU7)

(-) Exons   (0, 0)

(no "Exon" information available for 4YU7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:121
                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh.hhhhhhh...............hhhhhhhhhhhhhhhh............eeee..eeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yu7 A   1 SLFELGKMILQETGKNPAKSYGAYGCNCGVLGRGKPKDATDRCCYVHKCCYKKLTGCNPKKDRYSYSWKDKTIVCGENNPCLKELCECDKAVAICLRENLGTYNKLYRYHLKPFCKKADDC 121
                                    10        20        30        40        50        60        70        80        90       100       110       120 


Chain B from PDB  Type:PROTEIN  Length:121
                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhh.hhhhhhh...............hhhhhhhhhhhhhhhh............eeee..eeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yu7 B   1 SLFELGKMILQETGKNPAKSYGAYGCNCGVLGRGKPKDATDRCCYVHKCCYKKLTGCNPKKDRYSYSWKDKTIVCGENNPCLKELCECDKAVAICLRENLGTYNKLYRYHLKPFCKKADDC 121
                                    10        20        30        40        50        60        70        80        90       100       110       120
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4YU7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4YU7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4YU7)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DHC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PE4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4yu7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4yu7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PA2H1_BOTPI | P58399
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PA2H1_BOTPI | P58399
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PA2H1_BOTPI | P58399: 2ok9 2q2j 3qnl 4yz7

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4YU7)