Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  TNNI3K COMPLEXED WITH INHIBITOR 1
 
Authors :  L. M. Shewchuk, L. Wang, B. G. Lawhorn
Date :  25 Feb 15  (Deposition) - 23 Sep 15  (Release) - 07 Oct 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Kinase, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. G. Lawhorn, J. Philp, Y. Zhao, C. Louer, M. Hammond, M. Cheung, H. Fries, A. P. Graves, L. Shewchuk, L. Wang, J. E. Cottom, H. Qi, H. Zhao R. Totoritis, G. Zhang, B. Schwartz, H. Li, S. Sweitzer, D. A. Holt, G. J. Gatto, L. S. Kallander
Identification Of Purines And 7-Deazapurines As Potent And Selective Type I Inhibitors Of Troponin I-Interacting Kinas (Tnni3K).
J. Med. Chem. V. 58 7431 2015
PubMed-ID: 26355916  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.5B00931

(-) Compounds

Molecule 1 - SERINE/THREONINE-PROTEIN KINASE TNNI3K
    Chains: A, B, C, D
    EC Number: 2.7.11.1
    Engineered: YES
    Expression System: UNIDENTIFIED BACULOVIRUS
    Expression System Plasmid: PFASTBAC
    Expression System Taxid: 10469
    Fragment: UNP RESIDUES 503-831
    Gene: TNNI3K, CARK
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CARDIAC ANKYRIN REPEAT KINASE,CARDIAC TROPONIN I-INTERACTING KINASE,TNNI3-INTERACTING KINASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
14CW4Ligand/IonN-METHYL-3-(9H-PURIN-6-YLAMINO)BENZENESULFONAMIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
14CW2Ligand/IonN-METHYL-3-(9H-PURIN-6-YLAMINO)BENZENESULFONAMIDE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
14CW2Ligand/IonN-METHYL-3-(9H-PURIN-6-YLAMINO)BENZENESULFONAMIDE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:469 , ALA A:488 , LYS A:490 , THR A:539 , GLN A:540 , TYR A:541 , ILE A:542 , LEU A:595 , ASP A:606 , HOH A:914binding site for residue 4CW A 801
2AC2SOFTWAREALA B:488 , GLU B:509 , THR B:539 , GLN B:540 , ILE B:542 , LEU B:595 , ASP B:606 , HOH B:916binding site for residue 4CW B 801
3AC3SOFTWAREILE C:469 , VAL C:477 , ALA C:488 , LYS C:490 , ILE C:537 , THR C:539 , GLN C:540 , TYR C:541 , ILE C:542 , LEU C:595 , ASP C:606 , HOH C:907binding site for residue 4CW C 801
4AC4SOFTWAREALA D:488 , GLU D:509 , ILE D:522 , THR D:539 , GLN D:540 , ILE D:542 , LEU D:595 , ASP D:606 , HOH D:913binding site for residue 4CW D 801

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4YFI)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Gly A:626 -Asn A:627

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4YFI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4YFI)

(-) Exons   (0, 0)

(no "Exon" information available for 4YFI)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:268
                                                                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh.hhh.eeeeeeee....eeeeeeee..eeeeeeee..hhhhhhhhhhhhhhh.......eeeee..hhhh.eeeee.....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh....ee....hhh.eee.....eee......ee...hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh...........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yfi A 441 EKADILLLRAGLPSHFHLQLSEIEFHEIIGSGSFGKVYKGRCRNKIVAIKRYRSDVDMFCREVSILCQLNHPCVIQFVGACLNDPSQFAIVTQYISGGSLFSLLHEQKRILDLQSKLIIAVDVAKGMEYLHNLTQPIIHRDLNSHNILLYEDGHAVVADFGESRFLQGNLRWMAPEVFTQCTRYTIKADVFSYALCLWEILTGEIPFAHLKPAAADMDMAYHHIRPPIGYSIPKPISSLLIRGWNACPEGRPEFSEVVMKLEECLCNI 726
                                   450       460       470       480       490  ||   507       517       527       537       547       557       567       577       587       597       607      |628       638       648       658       668       678       688       698       708       718        
                                                                              493|                                                                                                              614|                                                                                                    
                                                                               501                                                                                                               626                                                                                                    

Chain B from PDB  Type:PROTEIN  Length:262
                                                                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh.hhh.eeeeeeeee...eeeeeeee..eeeeeeee..hhhhhhhhhhhhh.........eeeee..hhhh.eeeee.....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh....ee....hhh.eee.....eee......ee...hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yfi B 451 GLPSHFHLQLSEIEFHEIIGSGSFGKVYKGRCRNKIVAIKRYRSDVDMFCREVSILCQLNHPCVIQFVGACLNDPSQFAIVTQYISGGSLFSLLHEQKRILDLQSKLIIAVDVAKGMEYLHNLTQPIIHRDLNSHNILLYEDGHAVVADFGESRFLQSGNLRWMAPEVFTQCTRYTIKADVFSYALCLWEILTGEIPFAHLKPAAADMDMAYHHIRPPIGYSIPKPISSLLIRGWNACPEGRPEFSEVVMKLEECLCNIELM 729
                                   460       470       480       490  ||   507       517       527       537       547       557       567       577       587       597       607       627       637       647       657       667       677       687       697       707       717       727  
                                                                    493|                                                                                                               615|                                                                                                       
                                                                     501                                                                                                                626                                                                                                       

Chain C from PDB  Type:PROTEIN  Length:269
                                                                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh.hhh.eeeeeeee....eeeeeeee..eeeeeeee..hhhhhhhhhhhhh.........eeeee..hhhh.eeeee.....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh....ee........eee.....eee......ee....hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh...........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yfi C 441 EKADILLLRAGLPSHFHLQLSEIEFHEIIGSGSFGKVYKGRCRNKIVAIKRYRSDVDMFCREVSILCQLNHPCVIQFVGACLNDPSQFAIVTQYISGGSLFSLLHEQKRILDLQSKLIIAVDVAKGMEYLHNLTQPIIHRDLNSHNILLYEDGHAVVADFGESRFLQSGNLRWMAPEVFTQCTRYTIKADVFSYALCLWEILTGEIPFAHLKPAAADMDMAYHHIRPPIGYSIPKPISSLLIRGWNACPEGRPEFSEVVMKLEECLCNI 726
                                   450       460       470       480       490  ||   507       517       527       537       547       557       567       577       587       597       607       627       637       647       657       667       677       687       697       707       717         
                                                                              493|                                                                                                               615|                                                                                                    
                                                                               501                                                                                                                626                                                                                                    

Chain D from PDB  Type:PROTEIN  Length:261
                                                                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhh.eehhh.eeeeeeeee....eeeeeee..eeeeeee..hhhhhhhhhhhhh.........eeeee..hhhh.eeeee.....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...ee........eee.....eee......ee.........hhhhhhhh....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4yfi D 451 GLPSHFHLQLSEIEFHEIIGSGSFGKVYKGRCRNKIVAIKRYSDVDMFCREVSILCQLNHPCVIQFVGACLNDPSQFAIVTQYISGGSLFSLLHEQKRILDLQSKLIIAVDVAKGMEYLHNLTQPIIHRDLNSHNILLYEDGHAVVADFGESRFLQSGNLRWMAPEVFTQCTRYTIKADVFSYALCLWEILTGEIPFAHLKPAAADMDMAYHHIRPPIGYSIPKPISSLLIRGWNACPEGRPEFSEVVMKLEECLCNIELM 729
                                   460       470       480       490 ||    508       518       528       538       548       558       568       578       588       598       608      |628       638       648       658       668       678       688       698       708       718       728 
                                                                   492|                                                                                                               615|                                                                                                       
                                                                    501                                                                                                                626                                                                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4YFI)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4YFI)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4YFI)

(-) Gene Ontology  (18, 18)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    4CW  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:626 - Asn A:627   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4yfi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TNI3K_HUMAN | Q59H18
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TNI3K_HUMAN | Q59H18
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TNI3K_HUMAN | Q59H18: 4yff

(-) Related Entries Specified in the PDB File

4yff