Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CATALYTICALLY INACTIVE MERS-COV 3CL PROTEASE (C148A) IN SPACEGROUP P212121
 
Authors :  G. T. Lountos, D. Needle, D. S. Waugh
Date :  08 Oct 14  (Deposition) - 13 May 15  (Release) - 27 May 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.97
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Mes, 3Cl Protease, Coronavirus, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Needle, G. T. Lountos, D. S. Waugh
Structures Of The Middle East Respiratory Syndrome Coronavirus 3C-Like Protease Reveal Insights Into Substrate Specificity.
Acta Crystallogr. , Sect. D V. 71 1102 2015
PubMed-ID: 25945576  |  Reference-DOI: 10.1107/S1399004715003521

(-) Compounds

Molecule 1 - MERS-COV 3CL PROTEASE
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PDN2551
    Expression System Taxid: 562
    Mutation: YES
    Organism Scientific: MIDDLE EAST RESPIRATORY SYNDROME CORONAVIRUS
    Organism Taxid: 1335626

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 11)

Asymmetric/Biological Unit (2, 11)
No.NameCountTypeFull Name
1PEG6Ligand/IonDI(HYDROXYETHYL)ETHER
2PG45Ligand/IonTETRAETHYLENE GLYCOL

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:200 , GLN A:241 , HOH A:784binding site for residue PEG A 401
02AC2SOFTWARETHR A:105 , PHE A:106 , HOH A:786binding site for residue PEG A 402
03AC3SOFTWARELYS A:91 , VAL A:256 , LYS A:257 , GLY A:259 , HOH A:509 , HOH A:524 , HOH A:614binding site for residue PEG A 403
04AC4SOFTWAREHIS B:41 , PHE B:143 , CYS B:145 , HIS B:166 , MET B:168 , GLU B:169 , LYS B:191 , PG4 B:405 , HOH B:575 , HOH B:687 , HOH B:713 , HOH B:725binding site for residue PG4 B 401
05AC5SOFTWAREMET A:6 , SER A:7 , HIS A:8 , MET A:298 , HOH A:599 , HOH A:659 , HOH A:740 , TYR B:121 , THR B:126 , HOH B:712binding site for residue PG4 B 402
06AC6SOFTWAREARG B:134 , ASP B:200 , TYR B:202 , HOH B:704binding site for residue PEG B 403
07AC7SOFTWARETYR B:104 , THR B:105 , PHE B:106 , HOH B:736 , GLY C:259binding site for residue PEG B 404
08AC8SOFTWAREGLU B:169 , LEU B:170 , GLN B:192 , PG4 B:401binding site for residue PG4 B 405
09AC9SOFTWARETYR A:121 , THR A:126 , HOH A:766 , HOH A:775 , MET B:6 , SER B:7 , HIS B:8 , MET B:298 , HOH B:640 , HOH B:644 , HOH B:716 , HOH B:751binding site for residue PG4 B 406
10AD1SOFTWARETHR B:258 , PHE C:106binding site for residue PEG C 401
11AD2SOFTWAREVAL B:256 , LYS B:257 , HOH B:510 , THR C:35 , TRP C:37 , GLN C:86 , LYS C:91 , HOH C:584binding site for residue PG4 C 402

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4WMF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4WMF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WMF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WMF)

(-) Exons   (0, 0)

(no "Exon" information available for 4WMF)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:304
                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhh.eeeeee..eeeeeeee..eeeee.hhhhhhhhh...hhhhhhhhhhhh.eeeee.....eee.eeeeeee..eeeeee.........eee.......eeeeeeee..eeeeeeeee..................eeeeee..eeeeeeeeeeeee..eeeee.....hhhhh..............hhhhhhhhhhhhhhh...........hhhhhhhhhhhh.......hhhhhhhhhhhh.hhhhhhhhhhhhhhh................hhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wmf A   1 SGLVKMSHPSDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVM 305
                                    10|       21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301    
                                    10|                                                                                                                                                                                                                                                                                                     
                                     12                                                                                                                                                                                                                                                                                                     


Chain B from PDB  Type:PROTEIN  Length:303
                                                                                                                                                                                                                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh.eeeeee..eeeeeeee..eeeee.hhhhhhhhh...hhhhhhhh.hhh.eeeee.....eee.eeeeeee..eeeeee.........eee.......eeeeeeee..eeeeeeeee..................eeeeee..eeeeeeeeeeeee..eeeee.....hhhhh..............hhhhhhhhhhhhhhh...........hhhhhhhhhhh........hhhhhhhhhhhh.hhhhhhhhhhhhhhh................hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wmf B   1 SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGV 303
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300   


Chain C from PDB  Type:PROTEIN  Length:289
                                                                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhh.eeeeee..eeeeeeee..eeeee.hhhh.....hhhhhhhh.hhh.eeeee.....eee.eeeeeee..eeeeee.........eee.......eeeeeeee..eeeeeeeee......ee..........eeeeee..eeeeeeeeeee...eeeee.....hhhhh...........hhhhhhhhhhhhhhhh..........hhhhhhhhhhh........hhhhhhhhhhhh.hhhhhhhhhhhhh..................hhhhhhhhhhh.ee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wmf C  11 GDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELAGTHTGSAFDGTMYGAFMDKQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ 306
                                    20        30        40      ||53        63        73        83        93       103       113       123       133       143       153       163       174       184       197       207       217       227       237       247       257       267       277       287       297         
                                                               47|                                                                                                                     171|                 193|                                                                                                             
                                                                51                                                                                                                      173                  197
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WMF)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WMF)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WMF)

(-) Gene Ontology  (22, 22)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PG4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4wmf)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wmf
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  W6A941_9BETC | W6A941
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  W6A941_9BETC | W6A941
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        W6A941_9BETC | W6A941: 4wmd 4wme

(-) Related Entries Specified in the PDB File

4wmd 4wme