Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF HEMAGGLUTININ FROM 1968 H3N2 INFLUENZA VIRUS
 
Authors :  H. Yang, P. J. Carney, J. C. Chang, Z. Guo, J. M. Villanueva, J. Stevens
Date :  09 Sep 14  (Deposition) - 11 Feb 15  (Release) - 11 Feb 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.35
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Hemagglutinin, H3, Influenza Virus (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Yang, P. J. Carney, J. C. Chang, Z. Guo, J. M. Villanueva, J. Stevens
Structure And Receptor Binding Preferences Of Recombinant Human A(H3N2) Virus Hemagglutinins.
Virology V. 477C 18 2015
PubMed-ID: 25617824  |  Reference-DOI: 10.1016/J.VIROL.2014.12.024

(-) Compounds

Molecule 1 - HEMAGGLUTININ HA1 CHAIN
    Chains: A
    Engineered: YES
    Expression System: TRICHOPLUSIA NI
    Expression System Taxid: 7111
    Fragment: UNP RESIDUES 25-345
    Gene: HA
    Organism Scientific: INFLUENZA A VIRUS
    Organism Taxid: 506350
    Strain: A/HONG KONG/1/1968 H3N2
 
Molecule 2 - HEMAGGLUTININ HA2 CHAIN
    Chains: B
    Engineered: YES
    Expression System: TRICHOPLUSIA NI
    Expression System Taxid: 7111
    Fragment: UNP RESIDUES 346-517
    Gene: HA
    Organism Scientific: INFLUENZA A VIRUS
    Organism Taxid: 506350
    Strain: A/HONG KONG/1/1968 H3N2

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 26)

Asymmetric/Biological Unit (5, 26)
No.NameCountTypeFull Name
1BMA3Ligand/IonBETA-D-MANNOSE
2MAN4Ligand/IonALPHA-D-MANNOSE
3NAG11Ligand/IonN-ACETYL-D-GLUCOSAMINE
4PE51Ligand/Ion3,6,9,12,15,18,21,24-OCTAOXAHEXACOSAN-1-OL
5PEG7Ligand/IonDI(HYDROXYETHYL)ETHER

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREMET A:268 , ARG A:269 , ILE A:300 , PEG A:418 , HOH A:563 , GLU B:67 , LYS B:68 , GLU B:69binding site for residue PEG A 417
02AC2SOFTWAREILE A:267 , LYS A:299 , ILE A:300 , THR A:301 , PEG A:417 , GLN B:65 , ILE B:66 , GLU B:67 , LYS B:68 , HOH B:336 , HOH B:343binding site for residue PEG A 418
03AC3SOFTWAREGLU B:69 , PHE B:70 , GLU B:72 , VAL B:73 , GLN B:78 , LYS B:82 , PEG B:206binding site for residue PEG B 203
04AC4SOFTWARELYS A:299 , ILE B:66 , GLU B:67 , LYS B:68 , GLU B:81 , LYS B:82 , GLU B:85 , ASP B:86binding site for residue PEG B 204
05AC5SOFTWAREHIS B:64 , GLN B:65 , ASP B:79 , TYR B:83 , ASP B:86 , PEG B:206binding site for residue PEG B 205
06AC6SOFTWAREVAL B:73 , GLU B:74 , GLY B:75 , GLN B:78 , ASP B:79 , LYS B:82 , PEG B:203 , PEG B:205 , HOH B:322binding site for residue PEG B 206
07AC7SOFTWARELYS A:307 , ARG B:54binding site for residue PEG B 207
08AC8SOFTWARETYR A:105 , ALA A:106 , ARG A:109 , SER A:110 , ARG A:269 , HOH A:537 , HIS B:64 , GLN B:65 , ILE B:66 , GLU B:67 , PHE B:70 , SER B:71 , GLU B:72 , GLU B:74 , ARG B:76 , ASP B:79 , GLU B:81 , HOH B:331 , HOH B:350 , HOH B:363binding site for residue PE5 B 208
09AC9SOFTWAREASN A:22 , THR A:37 , HOH A:676 , HOH A:714binding site for Mono-Saccharide NAG A 401 bound to ASN A 22
10AD1SOFTWAREASN A:38 , THR A:40 , ASN A:173 , PHE A:174 , PRO A:239 , THR A:318 , HOH A:514 , HOH A:529 , HOH A:704 , LEU B:52binding site for Poly-Saccharide residues NAG A 402 through NAG A 407 bound to ASN A 38
11AD2SOFTWAREGLN A:80 , ASN A:81 , PHE A:120 , GLN A:329 , HOH A:670binding site for Mono-Saccharide NAG A 416 bound to ASN A 81
12AD3SOFTWAREASN A:165 , THR A:167 , SER A:219 , PRO A:221 , TRP A:222 , HOH A:647binding site for Poly-Saccharide residues NAG A 408 through MAN A 412 bound to ASN A 165
13AD4SOFTWARESER A:45 , ASN A:285 , VAL A:297 , ASN A:298 , HOH A:572 , HOH A:611 , HOH A:716 , HOH B:337binding site for Poly-Saccharide residues NAG A 413 through BMA A 415 bound to ASN A 285
14AD5SOFTWAREALA B:147 , GLU B:150 , ASN B:154binding site for Poly-Saccharide residues NAG B 201 through NAG B 202 bound to ASN B 154

(-) SS Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1A:14 -B:137
2A:52 -A:277
3A:64 -A:76
4A:97 -A:139
5A:281 -A:305
6B:144 -B:148

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Asn A:54 -Pro A:55

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WE4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WE4)

(-) Exons   (0, 0)

(no "Exon" information available for 4WE4)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:321
                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee......eee.......eee..eee.ee......eeee...eee....hhhhhhhhhhhhhhhh.....eeee..........ee..hhhhhhhhhhhhh...eee.......ee....eeeee....ee....eee.ee.......eeeeee......eeeeeeeee..hhhhhhhhhh.....eeee....eeee...............eeeeeeeee....eeeeee...eeee.eeee......eeee....eeeee..eee..eee.....ee.......eee.ee......eee............ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4we4 A   9 STATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGIHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTQ 329
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328 


Chain B from PDB  Type:PROTEIN  Length:172
                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................eeeeeee..eeeeeehhhhhhhhhhhhhhhhhhhh...eee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee....eeee....hhhhhhhhhh....hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4we4 B   1 GLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRNEALNNRFQ 172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WE4)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WE4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WE4)

(-) Gene Ontology  (17, 17)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PE5  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:54 - Pro A:55   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4we4
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HEMA_I68A4 | Q91MA7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HEMA_I68A4 | Q91MA7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HEMA_I68A4 | Q91MA7: 3sdy 3ztj 4fnk 4fp8 4fqr 4fqy 4nm8 4ubd 4zcj 5k9k 5k9q 5kan 5kuy 5t6n 5thf 5umn 5vtq 5vtr 5vtu 5vtv 5vtw 5vtx 5vty 5vtz 5vu4

(-) Related Entries Specified in the PDB File

4we5 4we6 4we7 4we8 4we9 4wea