Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theor.Model - manually
(-)Theoretical Model
collapse expand < >
Image Theor.Model - manually
Theor.Model - manually  (Jmol Viewer)
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  RATIONAL DESIGN AND EXPRESSION OF A HEPARIN-TARGETED HUMAN SUPEROXIDE DISMUTASE
 
Authors :  L. A. Kuhn, C. L. Fisher, J. A. Tainer
Date :  14 Jan 93  (Deposition) - 30 Apr 94  (Release) - 30 Apr 94  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A  (2x)
Keywords :  Oxidoreductase(Superoxide Acceptor) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Boissinot, L. A. Kuhn, P. Lee, C. L. Fisher, Y. Wang, R. A. Hallewell, J. A. Tainer
Rational Design And Expression Of A Heparin-Targeted Human Superoxide Dismutase.
Biochem. Biophys. Res. Commun. V. 190 250 1993
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - COPPER,ZINC SUPEROXIDE DISMUTASE
    Chains: A
    EC Number: 1.15.1.1
    Engineered: YES
    Organism Scientific: HOMO SAPIENS

 Structural Features

(-) Chains, Units

  
Theoretical Model (2x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Theoretical Model (1, 1)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP

(-) Sites  (0, 0)

(no "Site" information available for 4SOD)

(-) SS Bonds  (1, 1)

Theoretical Model
No.Residues
1A:57 -A:146

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4SOD)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4SOD)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4SOD)

(-) Exons   (0, 0)

(no "Exon" information available for 4SOD)

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:172
                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee.....eeeeeeee......eeeeeeee....eeeeeeee..................................eeeeeee....eeeeeeee..............eeeee..........hhhhhhhh....eeeeee..........hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4sod A   0 xATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQGPGHRHHPREMKKRVEDL 171
                            |        9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169  
                            |                                                                                                                                                                           
                            0-ACE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4SOD)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4SOD)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4SOD)

(-) Gene Ontology  (100, 100)

Theoretical Model(hide GO term definitions)

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 4sod)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4sod)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4sod
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SODC_HUMAN | P00441
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.15.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  0079
    Age Related Information: GenAge
  0130
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SODC_HUMAN | P00441
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SODC_HUMAN | P00441: 1azv 1ba9 1dsw 1fun 1hl4 1hl5 1kmg 1l3n 1mfm 1n18 1n19 1oez 1ozt 1ozu 1p1v 1ptz 1pu0 1rk7 1sos 1spd 1uxl 1uxm 2af2 2c9s 2c9u 2c9v 2gbt 2gbu 2gbv 2lu5 2mp3 2nam 2nnx 2r27 2v0a 2vr6 2vr7 2vr8 2wko 2wyt 2wyz 2wz0 2wz5 2wz6 2xjk 2xjl 2zkw 2zkx 2zky 3cqp 3cqq 3ecu 3ecv 3ecw 3gqf 3gtv 3gzo 3gzp 3gzq 3h2p 3h2q 3hff 3k91 3kh3 3kh4 3ltv 3qqd 3re0 3t5w 4a7g 4a7q 4a7s 4a7t 4a7u 4a7v 4b3e 4bcy 4bcz 4bd4 4ff9 4mcm 4mcn 4nin 4nio 4nip 4oh2 4xcr 5dli 5iiw 5j07 5j0c 5j0f 5j0g 5k02 5u9m

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4SOD)