Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  TNRA-DNA COMPLEX
 
Authors :  M. A. Schumacher
Date :  08 Aug 14  (Deposition) - 04 Mar 15  (Release) - 04 Mar 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  B,G
Biol. Unit 1:  B,G  (2x)
Keywords :  New Family Of Transcription Regulators, Transcription, Gs, Transcription-Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. A. Schumacher, N. B. Chinnam, B. Cuthbert, N. K. Tonthat, T. Whitfil
Structures Of Regulatory Machinery Reveal Novel Molecular Mechanisms Controlling B. Subtilis Nitrogen Homeostasis.
Genes Dev. V. 29 451 2015
PubMed-ID: 25691471  |  Reference-DOI: 10.1101/GAD.254714.114

(-) Compounds

Molecule 1 - HTH-TYPE TRANSCRIPTIONAL REGULATOR TNRA
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentTNRA
    GeneTNRA, BMWSH_3277
    MutationYES
    Organism ScientificBACILLUS MEGATERIUM
    Organism Taxid1006007
    StrainWSH-002
 
Molecule 2 - DNA (5'- D(*CP*GP*TP*GP*TP*AP*AP*GP*GP*AP*AP*TP*TP*CP*TP*GP*AP*CP*AP*CP*G)- 3')
    ChainsG
    EngineeredYES
    Organism ScientificSYNTHETIC DNA
    Organism Taxid32630
    Other Details21-MER COGNATE DNA SITE
    SyntheticYES

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit BG
Biological Unit 1 (2x)BG

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4R22)

(-) Sites  (0, 0)

(no "Site" information available for 4R22)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4R22)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4R22)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4R22)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4R22)

(-) Exons   (0, 0)

(no "Exon" information available for 4R22)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain B from PDB  Type:PROTEIN  Length:82
                                                                                                                 
               SCOP domains ---------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhh.eeehhhhhhhhhh.hhhhhhhhhhh.....ee.....eeeehhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                  4r22 B  7 SYRDKKVMSIGIVKELTGLSERQIRYYEKRSLLFPDRTNTGIRKYSFSDVERLMDIADRIEEGVQTSEIRTELAKKDEARKM 88
                                    16        26        36        46        56        66        76        86  

Chain G from PDB  Type:DNA  Length:21
                                                    
                  4r22 G  0 CGTGTAAGGAATTCTGACACG 20
                                     9        19 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4R22)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4R22)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4R22)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4r22)
 
  Sites
(no "Sites" information available for 4r22)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4r22)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4r22
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TNRA_BACMW | G2RUZ1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TNRA_BACMW | G2RUZ1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TNRA_BACMW | G2RUZ14r24

(-) Related Entries Specified in the PDB File

4r24 TNRA-21MER, CRYSTAL FORM C2221
4r25 STRUCTURE OF B. SUBTILIS GLNK