Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE SORTILIN:NEUROTENSIN COMPLEX AT EXCESS NEUROTENSIN CONCENTRATION
 
Authors :  E. M. Quistgaard, M. K. Groftehauge, S. S. Thirup
Date :  25 Feb 14  (Deposition) - 23 Jul 14  (Release) - 24 Sep 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.66
Chains :  Asym./Biol. Unit :  A,N,P
Keywords :  10 Bladed Beta-Propeller, Protein Sorting Receptor, Neurotensin, Glycosylation, Trans Golgi Network, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. M. Quistgaard, M. K. Grftehauge, P. Madsen, L. T. Pallesen, B. Christensen, E. S. Srensen, P. Nissen, C. M. Petersen, S. S. Thirup
Revisiting The Structure Of The Vps10 Domain Of Human Sortilin And Its Interaction With Neurotensin.
Protein Sci. V. 23 1291 2014
PubMed-ID: 24985322  |  Reference-DOI: 10.1002/PRO.2512

(-) Compounds

Molecule 1 - SORTILIN
    ChainsA
    EngineeredYES
    Expression SystemCRICETULUS GRISEUS
    Expression System Cell LineCHO-K1
    Expression System Taxid10029
    FragmentUNP RESIDUES 78-756
    GeneSORT1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Synonym100 KDA NT RECEPTOR, GLYCOPROTEIN 95, GP95, NEUROTENSIN RECEPTOR 3, NT3, NTR3
 
Molecule 2 - NEUROTENSIN/NEUROMEDIN N
    ChainsN, P
    EngineeredYES
    FragmentUNP RESIDUES 151-163
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymLARGE NEUROMEDIN N, NMN-125, NEUROMEDIN N, NN, NMN, NEUROTENSIN, NT, TAIL PEPTIDE
    SyntheticYES

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ANP

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 9)

Asymmetric/Biological Unit (4, 9)
No.NameCountTypeFull Name
1BMA2Ligand/IonBETA-D-MANNOSE
2NAG5Ligand/IonN-ACETYL-D-GLUCOSAMINE
3PCA1Mod. Amino AcidPYROGLUTAMIC ACID
4PG41Ligand/IonTETRAETHYLENE GLYCOL

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:412 , SER A:413 , GLU A:414 , GLY A:459 , SER A:460 , VAL A:461 , PRO A:470 , ASP A:471 , TYR A:473 , LYS A:484 , HOH A:990BINDING SITE FOR RESIDUE PG4 A 808
2AC2SOFTWARELEU A:127 , ASN A:129 , PHE A:174 , GLN A:176 , HOH A:983BINDING SITE FOR MONO-SACCHARIDE NAG A 807 BOUND TO ASN A 129
3AC3SOFTWAREALA A:322 , ALA A:323 , ASN A:324 , ASN A:373 , THR A:375 , TYR A:381 , HOH A:944 , HOH A:948 , HOH A:950 , HOH A:956 , HOH A:964BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 373 RESIDUES 801 TO 803
4AC4SOFTWAREASP A:116 , TYR A:117 , LYS A:119 , SER A:547 , MET A:548 , ASN A:549 , ASP A:570 , ARG A:622BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 549 RESIDUES 804 TO 806

(-) SS Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1A:53 -A:523
2A:224 -A:244
3A:415 -A:425
4A:579 -A:618
5A:601 -A:633
6A:635 -A:690
7A:642 -A:655
8A:669 -A:707

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4PO7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4PO7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4PO7)

(-) Exons   (0, 0)

(no "Exon" information available for 4PO7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:658
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhh.eeeeee.....eeeeee.......eeeeee..............eeee.......ee.hhhhh.........eee.......eeee..........eeeee.......eeee.........eee..eeeeeeee.....eeee.......eeee..eeeeee.hhh.eeeee.............eeeee.......ee....eeeeeee..eeeeeee......eeeeee.......ee...........eeeeee....eeeeee......eeeeeee......eeeeeeeee..........ee.......eeeeee.....eeeeee......eee...................eeee.hhhhhhh.................eeeeeeee........eeeee.......eeee...eeeeeehhhheeeeee.......eeeee.......eeee.....eeeeeee........eeeeeeee......eeeeeee.hhh.....hhh.eeeee................eeeeeeee...............eeeee...hhh.eee...ee.....ee.....hhhhhhhhhhhhhhhh...eee..................hhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4po7 A  53 CGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSMCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSP 714
                                    62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552     ||563       573       583       593       603       613       623       633       643     ||656       666       676       686       696       706        
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   558|                                                                                      649|                                                             
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    560                                                                                       653                                                             

Chain N from PDB  Type:PROTEIN  Length:9
                                         
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author .eee..ee. Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 4po7 N   1 xLYENPYIL  13
                            |   ||   
                            1-PCA|   
                                10   

Chain P from PDB  Type:PROTEIN  Length:6
                                      
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 4po7 P   8 RRPYIL  13

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4PO7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4PO7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4PO7)

(-) Gene Ontology  (71, 73)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PCA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PG4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4po7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4po7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NEUT_HUMAN | P30990
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SORT_HUMAN | Q99523
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NEUT_HUMAN | P30990
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SORT_HUMAN | Q99523
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NEUT_HUMAN | P309902lne 2lnf 2lng 2lyw 2oyv 2oyw 3f6k
        SORT_HUMAN | Q995233f6k 3g2u 3g2v 4msl 4n7e 5mrh 5mri

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4PO7)