Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF GH10 ENDO-B-1,4-XYLANASE (XYNB) FROM XANTHOMONAS AXONOPODIS PV CITRI IN THE NATIVE FORM
 
Authors :  C. R. Santos, V. P. M. Martins, L. M. Zanphorlin, R. Ruller, M. T. Murakam
Date :  22 May 14  (Deposition) - 08 Oct 14  (Release) - 26 Nov 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.30
Chains :  Asym./Biol. Unit :  A
Keywords :  Xylanase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. R. Santos, Z. B. Hoffmam, V. P. De Matos Martins, L. M. Zanphorlin, L. H. De Paula Assis, R. V. Honorato, P. S. Lopes De Oliveira, R. Ruller, M. T. Murakami
Molecular Mechanisms Associated With Xylan Degradation By Xanthomonas Plant Pathogens.
J. Biol. Chem. V. 289 32186 2014
PubMed-ID: 25266726  |  Reference-DOI: 10.1074/JBC.M114.605105

(-) Compounds

Molecule 1 - XYLANASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA
    Expression System Taxid561
    GeneXYNB, XAC4254
    Organism ScientificXANTHOMONAS AXONOPODIS PV. CITRI
    Organism Taxid190486
    Strain306

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1CA1Ligand/IonCALCIUM ION

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:64 , ASP A:68 , GLU A:115 , GLN A:118 , HOH A:646 , HOH A:654binding site for residue CA A 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4PMX)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1His A:92 -Val A:93

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4PMX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4PMX)

(-) Exons   (0, 0)

(no "Exon" information available for 4PMX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:306
                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........eeeeee......hhhhhh..eee....hhhhhh.......hhhhhhhhhhhhhh....eeeeee......hhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeee................hhhhhh......hhhhhhhhhhhhhhh....eeee......hhhhhhhhhhhhhhhhhh....eeee..hhhhh....hhhhhhhhhhhhhh....eeeeee.....hhhhhhhhhhhhhhhhhh...eeeeee.......................hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4pmx A  22 AAPLAATASKFLGCAYGAQQAPGFAQYWNKLTPENGGKWGSVEAVRDQMDWSTLDAAYRFAQANQMPFQMHVMVWGNQQPEWIKTLRPAEQRREIEQWFAAVAQRYPDIALLEVVNEPLNDPPSKADTGGGNYLQALGGNGDSGWEWVLQSFRLARRHFPHTKLMINDYSITSSAQATQKYLQIVRLLQRENLVDAIGVQEHAFETTPEVAVSVHRDNLDALAATGLPIYITEFDLDGPTDAQQLADYKRVFPVFWEHPAVHGITLWGFRPGLWRDKEAAYLIRADGTERPALTWLRDYVAAHPGT 327
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4PMX)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4PMX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4PMX)

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    His A:92 - Val A:93   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4pmx
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8PET6_XANAC | Q8PET6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8PET6_XANAC | Q8PET6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8PET6_XANAC | Q8PET64pmy 4pmz 4pn2

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4PMX)