Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  VALA (2-EPI-5-EPI-VALIOLONE SYNTHASE) FROM STREPTOMYCES HYGROSCOPICUS SUBSP. JINGGANGENSIS 5008 WITH NAD+ AND ZN2+ BOUND
 
Authors :  K. M. Kean, S. J. Codding, P. A. Karplus
Date :  13 Mar 14  (Deposition) - 30 Jul 14  (Release) - 01 Oct 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Lyase, Sugar Phosphate Cyclase, Pseudoglycoside, Sedoheptulose 7- Phosphate (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. M. Kean, S. J. Codding, S. Asamizu, T. Mahmud, P. A. Karplus
Structure Of A Sedoheptulose 7-Phosphate Cyclase: Vala From Streptomyces Hygroscopicus.
Biochemistry V. 53 4250 2014
PubMed-ID: 24832673  |  Reference-DOI: 10.1021/BI5003508

(-) Compounds

Molecule 1 - CYCLASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneSHJG_0276
    Organism ScientificSTREPTOMYCES HYGROSCOPICUS SUBSP. JINGGANGENSIS
    Organism Taxid1133850
    Strain5008

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric Unit (3, 3)
No.NameCountTypeFull Name
1NAI1Ligand/Ion1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE
2PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
3ZN1Ligand/IonZINC ION
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1NAI2Ligand/Ion1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE
2PEG2Ligand/IonDI(HYDROXYETHYL)ETHER
3ZN-1Ligand/IonZINC ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:213 , HIS A:284 , HIS A:300 , HOH A:707binding site for residue ZN A 501
2AC2SOFTWAREASP A:70 , THR A:72 , VAL A:73 , LEU A:76 , GLU A:101 , LYS A:104 , GLY A:133 , GLY A:134 , VAL A:135 , ASP A:138 , THR A:158 , THR A:159 , ILE A:161 , ASP A:165 , ALA A:166 , LYS A:171 , LYS A:180 , ASN A:181 , PHE A:198 , THR A:201 , HIS A:206 , ASN A:209 , HOH A:663 , HOH A:667 , HOH A:714 , HOH A:724 , HOH A:728 , HOH A:770binding site for residue NAI A 502
3AC3SOFTWARESER A:29 , GLN A:261 , GLU A:265 , GLN A:268 , HOH A:605 , HOH A:648binding site for residue PEG A 503

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4P53)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Leu A:295 -Pro A:296

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4P53)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4P53)

(-) Exons   (0, 0)

(no "Exon" information available for 4P53)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:360
                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........eeee.........hhhhhh.eeeeeeehhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhhhhhhhhhh.......eeeeehhhhhhhhhhhhhhhhhh..eeeee.hhhhhhh.....eeeeee..eeeeeeee....eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh......hhhhh...hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh.....eeee.....eeee...hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4p53 A  26 WRVSALKEVSYDVVVQPRLLANPALADALSARRLIVIDATVRSLYGEQLAAYLAGHDVEFHLCVIDAHESAKVMETVFEVVDAMDAFGVPRRHAPVLAMGGGVLTDIVGLAASLYRRATPYVRIPTTLIGMIDAGIGAKTGVNFREHKNRLGTYHPSSLTLIDPGFLATLDARHLRNGLAEILKVALVKDAELFDLLEGHGASLVEQRMQPGAALTVLRRAVQGMLEELQPNLWEHQLRRLVDFGHSFSPSVEMAALPELLHGEAVCIDMALSSVLAHHRGLLTEAELGRVLDVMRLLHLPVLHPVCTPDLMRAALADTVKHRDGWQHMPLPRGIGDAVFVNDVTQREIEAALLTLAERD 398
                                    35        45|       57|       72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242||     258       268       278       288       298       308       318       328       338       348       358       368       378       388       398
                                              45|       57|                                                                                                                                                                                 243|                                                                                                                                                    
                                               48        63                                                                                                                                                                                  250                                                                                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4P53)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4P53)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4P53)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:295 - Pro A:296   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4p53
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  VALA_STRHJ | H2K887
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  VALA_STRHJ | H2K887
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4P53)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4P53)