Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF A CHICKEN ANTI-PROSTATE SPECIFIC ANTIGEN SCFV
 
Authors :  P. J. Conroy, R. H. P. Law, S. Gilgunn, S. Hearty, G. Llyod, T. T. Caradoc- R. J. O'Kennedy, J. C. Whisstock
Date :  12 Mar 14  (Deposition) - 23 Apr 14  (Release) - 14 Jan 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.40
Chains :  Asym./Biol. Unit :  A
Keywords :  Recombinant Antibody, Chicken, Cardiac Troponin I, Scfv, Immunoglobulin, Phage Display, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. J. Conroy, R. H. Law, S. Gilgunn, S. Hearty, T. T. Caradoc-Davies, G. Lloyd, R. J. O'Kennedy, J. C. Whisstock
Reconciling The Structural Attributes Of Avian Antibodies.
J. Biol. Chem. V. 289 15384 2014
PubMed-ID: 24737329  |  Reference-DOI: 10.1074/JBC.M114.562470

(-) Compounds

Molecule 1 - ANTIBODY SCFV B8
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PCOMB3X
    Expression System Taxid: 562
    Expression System Vector Type: PHAGEMID
    Organism Scientific: GALLUS GALLUS
    Organism Taxid: 9031

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric/Biological Unit (2, 5)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2SO44Ligand/IonSULFATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:25 , SER A:26 , GLN A:45 , CYS A:222 , SER A:223 , ASN A:227 , SO4 A:304 , HOH A:403 , HOH A:423 , HOH A:432binding site for residue SO4 A 301
2AC2SOFTWARETYR A:178 , ARG A:226 , HOH A:408 , HOH A:422binding site for residue SO4 A 302
3AC3SOFTWARETYR A:178 , CYS A:225 , ARG A:226 , ASN A:227 , HOH A:406 , HOH A:414 , HOH A:423 , HOH A:425binding site for residue SO4 A 303
4AC4SOFTWAREGLN A:45 , SO4 A:301 , HOH A:406 , HOH A:414 , HOH A:430binding site for residue SO4 A 304
5AC5SOFTWAREPRO A:54 , SER A:55 , HOH A:452binding site for residue ACT A 305

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1A:20 -A:83
2A:142 -A:217
3A:222 -A:225

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4P49)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4P49)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4P49)

(-) Exons   (0, 0)

(no "Exon" information available for 4P49)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:226
                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee....eeeeeee......eeeee.......eeee.............eeeeee..eeeeeee..hhhhheeeeeeeee..eeee...eeeee....eeeee..eee.....eeeeeeee..hhhhh.eeeeee.....eeeeeee.......eee.......eeeeee....eeeeee...hhhhheeeeeeee..........eeee...eeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4p49 A   1 ALTQPSSVSANPGETVKITCSGSSGSYGWYQQKSPDSAPVTVIYQSNQRPSDIPSRFSGSKSGSTGTLTITGVQAEDEAVYYCGGWGSSVGMFGAGTTLTVLGAVTLDESGGGLQTPGGALSLVCKASGFTFSSYAMGWVRQAPGKGLEWVAGISDDGDSYISYATAVKGRATISRDNGQSTVRLQLNNLRAEDTATYYCARSHCSGCRNAALIDAWGHGTEVIVS 243
                                    10        20        30        40        50        60        70        80        90       100  ||   127       137       147       157       167       177       187       197       207       217       227       237      
                                                                                                                                103|                                                                                                                          
                                                                                                                                 121
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4P49)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4P49)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4P49)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4P49)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4p49)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4p49
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4P49)

(-) Related Entries Specified in the PDB File

4p48