Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF SCLPMO10B IN COMPLEX WITH ZINC.
 
Authors :  Z. Forsberg, A. K. Mackenzie, M. Sorlie, A. K. Rohr, R. Helland, A. S. Arv G. Vaaje-Kolstad, V. G. H. Eijsink
Date :  11 Feb 14  (Deposition) - 28 May 14  (Release) - 25 Jun 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.40
Chains :  Asym./Biol. Unit :  A
Keywords :  Lpmo, Aa10, Cbm33, Pmo, Gh61, Cellulose Degradation, Copper Monooxygenase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. Forsberg, A. K. Mackenzie, M. Srlie, A. K. Rhr, R. Helland, A. S. Arvai, G. Vaaje-Kolstad, V. G. Eijsink
Structural And Functional Characterization Of A Conserved Pair Of Bacterial Cellulose-Oxidizing Lytic Polysaccharide Monooxygenases.
Proc. Natl. Acad. Sci. Usa V. 111 8446 2014
PubMed-ID: 24912171  |  Reference-DOI: 10.1073/PNAS.1402771111

(-) Compounds

Molecule 1 - PUTATIVE SECRETED CELLULOSE-BINDING PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PRSET B
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 43-228
    Gene: SCO0643
    Organism Scientific: STREPTOMYCES COELICOLOR
    Organism Taxid: 100226
    Strain: A3(2)
    Synonym: SCLPMO10B

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 11)

Asymmetric/Biological Unit (2, 11)
No.NameCountTypeFull Name
1ACT3Ligand/IonACETATE ION
2ZN8Ligand/IonZINC ION

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:226 , HOH A:407binding site for residue ZN A 301
02AC2SOFTWAREASP A:135 , HOH A:418binding site for residue ZN A 302
03AC3SOFTWARETYR A:94 , GLU A:118 , ZN A:304 , ACT A:310 , HOH A:403 , HOH A:404 , HOH A:415binding site for residue ZN A 303
04AC4SOFTWAREASP A:71 , TYR A:94 , GLU A:118 , ZN A:303 , ACT A:310 , HOH A:417binding site for residue ZN A 304
05AC5SOFTWAREHIS A:43 , ALA A:148 , HIS A:150 , ACT A:311binding site for residue ZN A 305
06AC6SOFTWAREASP A:48 , HOH A:559 , HOH A:566 , HOH A:582 , HOH A:583 , HOH A:645binding site for residue ZN A 306
07AC7SOFTWAREHIS A:145 , GLN A:147 , HOH A:627binding site for residue ZN A 307
08AC8SOFTWAREHIS A:145 , ASN A:190 , HOH A:654 , HOH A:661binding site for residue ZN A 308
09AC9SOFTWAREGLY A:202 , ARG A:203 , HOH A:407 , HOH A:443binding site for residue ACT A 309
10AD1SOFTWAREASP A:71 , TYR A:94 , GLU A:118 , ASP A:138 , ZN A:303 , ZN A:304 , HOH A:403 , HOH A:415 , HOH A:426binding site for residue ACT A 310
11AD2SOFTWAREHIS A:43 , ALA A:148 , HIS A:150 , GLN A:162 , GLY A:199 , ZN A:305 , HOH A:428 , HOH A:455binding site for residue ACT A 311

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:56 -A:76
2A:112 -A:222

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Asp A:48 -Pro A:49

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4OY8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4OY8)

(-) Exons   (0, 0)

(no "Exon" information available for 4OY8)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:186
                                                                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh....eee....hhhhhh...............hhhhhh......ee...eeeeeeee.....eeeeeeeee...........hhh.eeeeee........eeeeeee......eeeeeeeeee....eeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4oy8 A  43 HGSVVDPASRNYGCWERWGDDFQNPAMADEDPMCWQAWQDDPNAMWNWNGLYRNGSAGDFEAVVPDGQLCSGGRTESGRYNSLDAVGPWQTTDVTDDFTVKLHDQASHGADYFLVYVTKQGFDPATQALTWGELQQVARTGSYGPSQNYEIPVSTSGLTGRHVVYTIWQASHMDQTYFLCSDVDFG 228
                                    52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4OY8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4OY8)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4OY8)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp A:48 - Pro A:49   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4oy8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9RJC1_STRCO | Q9RJC1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9RJC1_STRCO | Q9RJC1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q9RJC1_STRCO | Q9RJC1: 4oy6

(-) Related Entries Specified in the PDB File

4oy6 4oy7