Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CHORISMATE SYNTHASE FROM ACINETOBACTER BAUMANNII AT 2.50A RESOLUTION
 
Authors :  P. K. Shukla, A. Chaudhary, N. Singh, M. Sinha, A. Bhushan, P. Kaur, S. Sh T. P. Singh
Date :  07 Jan 14  (Deposition) - 22 Jan 14  (Release) - 22 Jan 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Chorismate Synthase, Synthase, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. K. Shukla, A. Chaudhary, N. Singh, M. Sinha, A. Bhushan, P. Kaur, S. Sharma, T. P. Singh
Crystal Structure Of Chorismate Synthase From Acinetobacter Baumannii At 2. 50A Resolution
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CHORISMATE SYNTHASE
    Chains: A, B
    EC Number: 4.2.3.5
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28A
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: AROC
    Organism Scientific: ACINETOBACTER BAUMANNII
    Organism Taxid: 575584
    Strain: ATCC 19606
    Synonym: 5-ENOLPYRUVYLSHIKIMATE-3-PHOSPHATE PHOSPHOLYASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4OB9)

(-) Sites  (0, 0)

(no "Site" information available for 4OB9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4OB9)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Glu A:61 -Pro A:62
2Pro A:221 -Val A:222
3Thr A:259 -Arg A:260
4Pro A:356 -Pro A:357
5Pro B:221 -Val B:222
6Pro B:356 -Pro B:357

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4OB9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4OB9)

(-) Exons   (0, 0)

(no "Exon" information available for 4OB9)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:313
                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains d4ob9a_ A: Chorismate synthase, AroC                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee....eeeee......eeeeeee........hhhhhhhhhhh.................eee...ee..ee....eeeeee..............hhhhhhhhhhhhhhhhhhhh.eeeeeeeee..ee....................hhhhhhhhhhhhhhhh....eeeeeeee............hhhhhhhhhhh....eeeeee.hhhhhhhh.....................ee..ee....eeeeeee..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ob9 A   1 MAGNSIGQLFRVTTCGESHGVGLMAIVDGVPPGLALTEEDLQKDLDRRKPGTSKFATQRKEPDQVEIISGVFEGKTTGTPIGLLIRNTDQKGGGRSSARETAMRVAAGAIAKKYLAEKFGVLIRGHVTQIGNEVAEKLDWNEVPNNPFFCGDVDAVPRFEALVTSLREQGTSCGAKLEILAEKVPVGWGEPVFDRLDADIAHAMMSINAVKGVEIGDGFAVAGQFGHETRDELTSHGFLANHAGGILGGISSGQTIRVAIALKPTAKGRHDPCVGVRATPIAEAMLAIVLMDHFLRHRAQNADVVPPFAPIEP 363
                                    10        20        30        40        50        60        70        80        90||     130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290     ||320       330       340       350       360   
                                                                                                                     91|                                                                                                                                                                           296|                                              
                                                                                                                     122                                                                                                                                                                            317                                              


Chain B from PDB  Type:PROTEIN  Length:313
                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains d4ob9b_ B: Chorismate synthase, AroC                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee....eeeeee.....eeeeeee........hhhhhhhhhhh.................eeeee.ee..ee....eeeeee..............hhhhhhhhhhhhhhhhhhhh.eeeeeeeee..ee.......hhhhh........hhhhhhhhhhhhhhhh....eeeeeeee............hhhhhhhhhhh....eeeeee.hhhhhhhh.....................ee..ee....eeeeeee..........hhhhhhhhhhhhhhhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ob9 B   1 MAGNSIGQLFRVTTCGESHGVGLMAIVDGVPPGLALTEEDLQKDLDRRKPGTSKFATQRKEPDQVEIISGVFEGKTTGTPIGLLIRNTDQKGGGRSSARETAMRVAAGAIAKKYLAEKFGVLIRGHVTQIGNEVAEKLDWNEVPNNPFFCGDVDAVPRFEALVTSLREQGTSCGAKLEILAEKVPVGWGEPVFDRLDADIAHAMMSINAVKGVEIGDGFAVAGQFGHETRDELTSHGFLANHAGGILGGISSGQTIRVAIALKPTAKGRHDPCVGVRATPIAEAMLAIVLMDHFLRHRAQNADVVPPFAPIEP 363
                                    10        20        30        40        50        60        70        80        90||     130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290     ||320       330       340       350       360   
                                                                                                                     91|                                                                                                                                                                           296|                                              
                                                                                                                     122                                                                                                                                                                            317
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4OB9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4OB9)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4ob9)
 
  Sites
(no "Sites" information available for 4ob9)
 
  Cis Peptide Bonds
    Glu A:61 - Pro A:62   [ RasMol ]  
    Pro A:221 - Val A:222   [ RasMol ]  
    Pro A:356 - Pro A:357   [ RasMol ]  
    Pro B:221 - Val B:222   [ RasMol ]  
    Pro B:356 - Pro B:357   [ RasMol ]  
    Thr A:259 - Arg A:260   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ob9
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  D0C7F3_ACIB2 | D0C7F3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  4.2.3.5
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  D0C7F3_ACIB2 | D0C7F3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        D0C7F3_ACIB2 | D0C7F3: 4lj2 4o90

(-) Related Entries Specified in the PDB File

4lj2 4o90