Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AN INOSITOL HEXAKISPHOSPHATE KINASE APO-EHIP6KA
 
Authors :  H. Wang, S. B. Shears
Date :  18 Dec 13  (Deposition) - 18 Jun 14  (Release) - 09 Jul 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Pdkg Kinase, Inositol Phosphate, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Wang, E. F. Derose, R. E. London, S. B. Shears
Ip6K Structure And The Molecular Determinants Of Catalytic Specificity In An Inositol Phosphate Kinase Family.
Nat Commun V. 5 4178 2014
PubMed-ID: 24956979  |  Reference-DOI: 10.1038/NCOMMS5178

(-) Compounds

Molecule 1 - INOSITOL HEXAKISPHOSPHATE KINASE
    Chains: A, B
    EC Number: 2.7.4.21
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PDEST566
    Expression System Strain: ARCTICEXPRESS (DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 20-270
    Gene: EHI7A_103520
    Organism Scientific: ENTAMOEBA HISTOLYTICA
    Organism Taxid: 885318

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4O4C)

(-) Sites  (0, 0)

(no "Site" information available for 4O4C)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4O4C)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Glu A:145 -Lys A:146
2Glu B:145 -Lys B:146

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4O4C)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4O4C)

(-) Exons   (0, 0)

(no "Exon" information available for 4O4C)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:241
                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee..hhhhhhhhhhhh.............eeeeeeeee..eeeeeeeee........eeeeeeee.........hhhhhhhhhhhhhhhhhhhhheeeeeeee.......eeehhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh...eee..eeeeeeee.........eeeeee....eee..........hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4o4c A  30 HPDGQYLLKPCLSHRERDFYLHIKDDKEWTGTGIIPKFYGVELHEFGFGELEFIRMENLMYKYKRPFVLDLKIGTQTWDPETASSKMKKRLVVDSTSTTTSLGVRFSGMERNIGEEKPILYSRYLCTHEVNTRDSLKEYIKLFFNDGKKYRKELVPYFISQLDKMIEVMKKREYKMFSSSVLFVYDSTTTLEDKKYNCKMIDFAHNWILSEEECTVEDGFLFGLNNLKSILEDIENEFKSL 270
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269 


Chain B from PDB  Type:PROTEIN  Length:241
                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee..hhhhhhhhhhhh.............eeeeeeeee..eeeeeeeee........eeeeeeee.........hhhhhhhhhhhhhhhhhhhhheeeeeeee.......eeehhhhhhh...hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh...eee..eeeeeeee.........eeeeee....eee..........hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4o4c B  30 HPDGQYLLKPCLSHRERDFYLHIKDDKEWTGTGIIPKFYGVELHEFGFGELEFIRMENLMYKYKRPFVLDLKIGTQTWDPETASSKMKKRLVVDSTSTTTSLGVRFSGMERNIGEEKPILYSRYLCTHEVNTRDSLKEYIKLFFNDGKKYRKELVPYFISQLDKMIEVMKKREYKMFSSSVLFVYDSTTTLEDKKYNCKMIDFAHNWILSEEECTVEDGFLFGLNNLKSILEDIENEFKSL 270
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4O4C)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4O4C)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4O4C)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4o4c)
 
  Sites
(no "Sites" information available for 4o4c)
 
  Cis Peptide Bonds
    Glu A:145 - Lys A:146   [ RasMol ]  
    Glu B:145 - Lys B:146   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4o4c
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  N9UNA8_ENTHI | N9UNA8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.7.4.21
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  N9UNA8_ENTHI | N9UNA8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        N9UNA8_ENTHI | N9UNA8: 4o4b 4o4d 4o4e 4o4f

(-) Related Entries Specified in the PDB File

4o4b 4o4d 4o4e 4o4f