Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  ENAH-EVH1 IN COMPLEX WITH PEPTIDOMIMETIC LOW-MOLECULAR WEIGHT INHIBITOR AC-[2-CL-F]-[PROM-2]-[PROM-1]-OH
 
Authors :  M. Barone, Y. Roske, R. Kuehne
Date :  27 Sep 13  (Deposition) - 15 Oct 14  (Release) - 22 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Molecular Recognition, Actin Dynamics, Cell Adhesion-Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Opitz, M. Muller, C. Reuter, M. Barone, A. Soicke, Y. Roske, K. Piotukh, P. Huy, M. Beerbaum, B. Wiesner, M. Beyermann, P. Schmieder, C. Freund, R. Volkmer, H. Oschkinat, H. G. Schmalz, R. Kuhne
A Modular Toolkit To Inhibit Proline-Rich Motif-Mediated Protein-Protein Interactions.
Proc. Natl. Acad. Sci. Usa V. 112 5011 2015
PubMed-ID: 25848013  |  Reference-DOI: 10.1073/PNAS.1422054112

(-) Compounds

Molecule 1 - PROTEIN ENABLED HOMOLOG
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21 (DE3)
    Expression System Taxid469008
    Expression System Vector TypePGEX-4T1
    FragmentEVH1 DOMAIN
    GeneENAH, MENA
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric Unit (2, 4)
No.NameCountTypeFull Name
13VH2Ligand/Ion(3AR,5AS,8S,10AS)-1-[(3S,6R,8AS)-1'-[(2S)-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-5-OXIDANYLIDENE-SPIRO[1,2,3,8A-TETRAHYDROINDOLIZINE-6,2'-PYRROLIDINE]-3-YL]CARBONYL-10-OXIDANYLIDENE-2,3,3A,5A,8,10A-HEXAHYDRODIPYRROLO[3,2-B:3',1'-F]AZEPINE-8-CARBOXYLICACID
2BR2Ligand/IonBROMIDE ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
13VH1Ligand/Ion(3AR,5AS,8S,10AS)-1-[(3S,6R,8AS)-1'-[(2S)-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-5-OXIDANYLIDENE-SPIRO[1,2,3,8A-TETRAHYDROINDOLIZINE-6,2'-PYRROLIDINE]-3-YL]CARBONYL-10-OXIDANYLIDENE-2,3,3A,5A,8,10A-HEXAHYDRODIPYRROLO[3,2-B:3',1'-F]AZEPINE-8-CARBOXYLICACID
2BR-1Ligand/IonBROMIDE ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
13VH1Ligand/Ion(3AR,5AS,8S,10AS)-1-[(3S,6R,8AS)-1'-[(2S)-2-ACETAMIDO-3-(2-CHLOROPHENYL)PROPANOYL]-5-OXIDANYLIDENE-SPIRO[1,2,3,8A-TETRAHYDROINDOLIZINE-6,2'-PYRROLIDINE]-3-YL]CARBONYL-10-OXIDANYLIDENE-2,3,3A,5A,8,10A-HEXAHYDRODIPYRROLO[3,2-B:3',1'-F]AZEPINE-8-CARBOXYLICACID
2BR-1Ligand/IonBROMIDE ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:16 , TRP A:23 , LYS A:69 , ASN A:71 , PHE A:77 , GLN A:79 , ARG A:81 , VAL A:86 , HOH A:305 , HOH A:308 , HOH A:318 , HOH A:336 , HOH A:340 , HOH A:380 , TYR B:16 , ASP B:18 , ASN B:20 , LYS B:22 , HOH B:370BINDING SITE FOR RESIDUE 3VH A 201
2AC2SOFTWAREGLY A:42BINDING SITE FOR RESIDUE BR A 202
3AC3SOFTWAREASP A:18 , HOH A:380 , TYR B:16 , TRP B:23 , ASN B:71 , PHE B:77 , GLN B:79 , ARG B:81 , VAL B:86 , HOH B:330 , HOH B:346 , HOH B:347 , HOH B:350 , HOH B:352BINDING SITE FOR RESIDUE 3VH B 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4MY6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4MY6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4MY6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4MY6)

(-) Exons   (0, 0)

(no "Exon" information available for 4MY6)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:110
                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeeeeee....eeee.hhh..eeeeeeeee....eeeeeeee.....eeeeeee......ee....eeeee....eeeeee.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 4my6 A   2 SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVL 111
                                    11        21        31        41        51        61        71        81        91       101       111

Chain B from PDB  Type:PROTEIN  Length:112
                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeeeeeeee....eeee......eeeeeeeee....eeeeeeee.....eeeeee.......eeee..eeeee....eeeeee.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------- Transcript
                 4my6 B   0 SMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVL 111
                                     9        19        29        39        49        59        69        79        89        99       109  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4MY6)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4MY6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4MY6)

(-) Gene Ontology  (15, 15)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3VH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4my6)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4my6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ENAH_HUMAN | Q8N8S7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ENAH_HUMAN | Q8N8S7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ENAH_HUMAN | Q8N8S72ho2 2iyb 2xqn 5n91 5n9c 5n9p 5naj 5nbf 5ncf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4MY6)