4MQ0 - JenaLib

Title :   CRYSTAL STRUCTURE OF PARKIA BIGLOBOSA SEED LECTIN (PBL) IN COMPLEX WITH METHYL ALPHA D-MANNOPYRANOSIDE

Authors :   C. S. Teixeira, B. A. M. Rocha, H. C. Silva, A. U. Bari, I. L. Barroso-Neto M. Q. Santiago, C. S. Nagano, K. S. Nascimento, H. Debray, P. Delatorre B. S. Cavada

Date :   14 Sep 13 (Deposition) - 17 Dec 14 (Release) - 17 Dec 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.12

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)

Keywords :   Beta-Prism Domain, Lectin, Carbohydrate Binding Protein, Protein Bodies Of Seeds, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. S. Teixeira, B. A. M. Rocha, H. C. Silva, A. U. Bari, I. T. Barroso-Neto, M. Q. Santiago, C. S. Nagano, K. S. Nascimento, H. Debray, P. Delatorre, B. S. Cavada
Crystal Structure Of Parkia Biglobosa Seed Lectin (Pbl) In Complex With Methyl Alpha D-Mannopyranoside
To Be Published
PubMed: search

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 3)

Sites (3, 3)

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:15 , GLY A:16 , GLY A:136 , TYR A:137 , TYR A:138 , ASP A:140 , ASN A:221	BINDING SITE FOR RESIDUE MMA A 501
2	AC2	SOFTWARE	GLY A:309 , GLY A:310 , GLY A:430 , ASP A:431 , TYR A:432 , ASP A:434	BINDING SITE FOR RESIDUE MMA A 502
3	AC3	SOFTWARE	ALA A:163 , GLY A:164 , ASP A:165 , GLY A:281 , TYR A:282 , TYR A:283 , ASP A:285 , HOH A:686	BINDING SITE FOR RESIDUE MMA A 503

SS Bonds (0, 0)

Cis Peptide Bonds (8, 8)

Asymmetric Unit

No.	Residues
1	Gly A:9	-	Pro A:10
2	Trp A:74	-	Pro A:75
3	Gly A:108	-	Pro A:109
4	Gly A:157	-	Pro A:158
5	Gly A:254	-	Pro A:255
6	Gly A:303	-	Pro A:304
7	Trp A:366	-	Pro A:367
8	Gly A:403	-	Pro A:404

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:438
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeee....eeeeee....eeeeeeee...eeeeeeee........ee....hhhhhheeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eeee...ee.eeeeeeeeee...eeeeeeeeee.....eeeeeee.....eeeeee....eeeeeeee...eeeeeeee..................eeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eee...ee.eeeeeeeeee...eeeeeeeeee....eeeeeee....eeeeee....eeeeeeee...eeeeeeee........ee........eeeeee.......eeeeeeeeeeee...eeeeeeeeeeee...eeeeee....eee......eeeeeeeeee...eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4mq0 A   4 GMISVGPWGGSGGDHWSFKANHAITEILIHVKDNIKSISFKDAGGDISGTFGGKDPRENKKGEEKKIGIRWPTEYLKSISGSYGDYNGILVIRSLSFITNLTTYGPFGSTSGGESFSIPIADSVVVGFHGRAGYYLDALGIFVQPVPHRTISFGPWGGPAGDDAFNFKVGSWIKDIIVYADATINSIAFKDADGHCEKFGGQDPNDIGVEEKVEIDGNLEHLTSISGTYGNYKGFEVLTSLSFITNVTKHGPFGIASGTSFSRPIEGSLVTGFHGKGGYYLDSIGIYVKPRDGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSNIKSIAFKDTSGLDSATFGGVNPKDTGEKNTVSIKWPSEYLTSIDGTYGQYKFKDVFTTVTSLSFTTNLATYGPFGKASLTSFSIPIHNNMVVGFHGRAGDYLDAIGIFVKPD 443
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293 ||    305       315       325       335       345       355       365       375       385       395       405       415       425       435        
                                                                                                                                                                                                                                                                                                                             295|                                                                                                                                                 
                                                                                                                                                                                                                                                                                                                              298

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (0, 0)

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MMA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:108 - Pro A:109	[ RasMol ]
		Gly A:157 - Pro A:158	[ RasMol ]
		Gly A:254 - Pro A:255	[ RasMol ]
		Gly A:303 - Pro A:304	[ RasMol ]
		Gly A:403 - Pro A:404	[ RasMol ]
		Gly A:9 - Pro A:10	[ RasMol ]
		Trp A:366 - Pro A:367	[ RasMol ]
		Trp A:74 - Pro A:75	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	4mq0
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT

Description