Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF BRUCELLA ABORTUS PLIC IN COMPLEX WITH HUMAN LYSOZYME
 
Authors :  N. C. Ha, S. H. Um, J. S. Kim
Date :  06 Sep 13  (Deposition) - 23 Jul 14  (Release) - 23 Jul 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Inhibitor, Lysozyme, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. H. Um, J. S. Kim, K. Kim, N. Kim, H. S. Cho, N. C. Ha
Structural Basis For The Inhibition Of Human Lysozyme By Plic From Brucella Abortus
Biochemistry V. 52 9385 2013
PubMed-ID: 24308818  |  Reference-DOI: 10.1021/BI401241C

(-) Compounds

Molecule 1 - LYSOZYME C
    Chains: A, C
    EC Number: 3.2.1.17
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 19-148
    Gene: LYZ, LZM
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: 1,4-BETA-N-ACETYLMURAMIDASE C
 
Molecule 2 - HUMANLYSOZYME
    Chains: B, D
    Engineered: YES
    Expression System: RICE
    Expression System Taxid: 4530
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4ML7)

(-) Sites  (0, 0)

(no "Site" information available for 4ML7)

(-) SS Bonds  (10, 10)

Asymmetric Unit
No.Residues
1A:6 -A:128
2A:30 -A:116
3A:65 -A:81
4A:77 -A:95
5B:47 -B:118
6C:6 -C:128
7C:30 -C:116
8C:65 -C:81
9C:77 -C:95
10D:47 -D:118

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Cys A:128 -Gly A:129

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ML7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ML7)

(-) Exons   (0, 0)

(no "Exon" information available for 4ML7)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:129
                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.....eeee....eeee....ee...................hhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhhh....hhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ml7 A   1 KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCG 129
                                    10        20        30        40        50        60        70        80        90       100       110       120         


Chain B from PDB  Type:PROTEIN  Length:98
                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.......eeeeeeeee..eeeeeeeeee..eeeeeee....eeeeeee.....eeeee..eeeeee..eeeeee..........eeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                 4ml7 B  24 AMGEITIKLPDSVKVSTNSILYKCGAKDLSVTYYNAGDISLAKLELEDETVVASNVISGSGAKYAGSVYIWWTKGKTASLYNLIDNPEEDKPISCVEQ 121
                                    33        43        53        63        73        83        93       103       113        


Chain C from PDB  Type:PROTEIN  Length:130
                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.....eeee....eeee....ee...................hhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhhh....hhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ml7 C   1 KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV 130
                                    10        20        30        40        50        60        70        80        90       100       110       120       130


Chain D from PDB  Type:PROTEIN  Length:98
                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.......eeeeeeeee..eeeeeeeeee..eeeeeeee..eeeeeeee.....eeeee..eeeeee..eeeeee..........eeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                 4ml7 D  24 AMGEITIKLPDSVKVSTNSILYKCGAKDLSVTYYNAGDISLAKLELEDETVVASNVISGSGAKYAGSVYIWWTKGKTASLYNLIDNPEEDKPISCVEQ 121
                                    33        43        53        63        73        83        93       103       113
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ML7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ML7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ML7)

(-) Gene Ontology  (14, 14)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4ml7)
 
  Sites
(no "Sites" information available for 4ml7)
 
  Cis Peptide Bonds
    Cys A:128 - Gly A:129   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ml7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LYSC_HUMAN | P61626
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.17
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  LYSC_HUMAN | P61626
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LYSC_HUMAN | P61626: 133l 134l 1b5u 1b5v 1b5w 1b5x 1b5y 1b5z 1b7l 1b7m 1b7n 1b7o 1b7p 1b7q 1b7r 1b7s 1bb3 1bb4 1bb5 1c43 1c45 1c46 1c7p 1cj6 1cj7 1cj8 1cj9 1ckc 1ckd 1ckf 1ckg 1ckh 1d6p 1d6q 1di3 1di4 1di5 1eq4 1eq5 1eqe 1gay 1gaz 1gb0 1gb2 1gb3 1gb5 1gb6 1gb7 1gb8 1gb9 1gbo 1gbw 1gbx 1gby 1gbz 1gdw 1gdx 1ge0 1ge1 1ge2 1ge3 1ge4 1gev 1gez 1gf0 1gf3 1gf4 1gf5 1gf6 1gf7 1gf8 1gf9 1gfa 1gfe 1gfg 1gfh 1gfj 1gfk 1gfr 1gft 1gfu 1gfv 1hnl 1i1z 1i20 1i22 1inu 1ioc 1ip1 1ip2 1ip3 1ip4 1ip5 1ip6 1ip7 1iwt 1iwu 1iwv 1iww 1iwx 1iwy 1iwz 1ix0 1iy3 1iy4 1jka 1jkb 1jkc 1jkd 1jsf 1jwr 1laa 1lhh 1lhi 1lhj 1lhk 1lhl 1lhm 1lmt 1loz 1lyy 1lz1 1lz4 1lz5 1lz6 1lzr 1lzs 1op9 1oua 1oub 1ouc 1oud 1oue 1ouf 1oug 1ouh 1oui 1ouj 1qsw 1re2 1rem 1rex 1rey 1rez 1tay 1tby 1tcy 1tdy 1ubz 1w08 1wqm 1wqn 1wqo 1wqp 1wqq 1wqr 1yam 1yan 1yao 1yap 1yaq 207l 208l 2bqa 2bqb 2bqc 2bqd 2bqe 2bqf 2bqg 2bqh 2bqi 2bqj 2bqk 2bql 2bqm 2bqn 2bqo 2hea 2heb 2hec 2hed 2hee 2hef 2lhm 2mea 2meb 2mec 2med 2mee 2mef 2meg 2meh 2mei 2nwd 2zij 2zik 2zil 2zwb 3eba 3fe0 3lhm 3ln2 4i0c 4r0p 5lsh 5lvk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4ML7)