Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF D-GALACTOSE-6-PHOSPHATE ISOMERASE IN COMPLEX WITH D-PSICOSE
 
Authors :  W. S. Jung, C. H. Pan
Date :  27 Jun 13  (Deposition) - 27 Nov 13  (Release) - 27 Nov 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (2x)
Keywords :  Rossmann-Like Alpha-Beta-Alpha Sandwich Fold, Rossmann Fold, Isomerase, Sugar-Phosphate Binding, Isomerization (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  W. S. Jung, R. K. Singh, J. K. Lee, C. H. Pan
Crystal Structure And Substrate Specificity Of D-Galactose-6-Phosphate Isomerase Complexed With Substrates
Plos One V. 8 72902 2013
PubMed-ID: 24015281  |  Reference-DOI: 10.1371/JOURNAL.PONE.0072902

(-) Compounds

Molecule 1 - GALACTOSE-6-PHOSPHATE ISOMERASE SUBUNIT A
    Chains: A, C
    EC Number: 5.3.1.26
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: LACA, LC705_00641
    Organism Scientific: LACTOBACILLUS RHAMNOSUS
    Organism Taxid: 568704
    Strain: LC 705
    Synonym: LACA
 
Molecule 2 - GALACTOSE-6-PHOSPHATE ISOMERASE SUBUNIT B
    Chains: B, D
    EC Number: 5.3.1.26
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: LACB, LC705_00640
    Organism Scientific: LACTOBACILLUS RHAMNOSUS
    Organism Taxid: 568704
    Strain: LC 705

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (2x): ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1PSJ2Ligand/IonD-PSICOSE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1PSJ4Ligand/IonD-PSICOSE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:96 , ASN A:97 , ARG A:134 , HOH A:225 , ASP B:8 , HIS B:9 , ILE B:10 , TYR B:42 , CYS B:65 , GLY B:66 , THR B:67 , GLY B:70 , HOH B:332 , HOH B:341BINDING SITE FOR RESIDUE PSJ B 201
2AC2SOFTWAREHIS C:96 , ASN C:97 , ARG C:134 , HOH C:233 , ASP D:8 , TYR D:42 , CYS D:65 , GLY D:66 , THR D:67 , GLY D:70 , HOH D:336 , HOH D:342BINDING SITE FOR RESIDUE PSJ D 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4LFM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4LFM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4LFM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4LFM)

(-) Exons   (0, 0)

(no "Exon" information available for 4LFM)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:142
                                                                                                                                                                              
               SCOP domains d4lfma_ A: automated matches                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhhhh....eeeee..hhhhhhhhh......eee..hhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4lfm A   1 MDVIIGADKDGFAMKEQVKKYLEEHQYRVADVTPEPAEDFVESSLAVTKKLLNSDAHKAIMFDRYGVGSAMASNKVKGMVTAVVEEENTAHMTAEHNGAKAIAIGTGITGYDRALVIIQRYLDTEYAGGRHQIRLDMLEKMI 142
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140  


Chain B from PDB  Type:PROTEIN  Length:172
                                                                                                                                                                                                            
               SCOP domains d4lfmb_ B: automated matches                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhhhhh..eeee.........hhhhhhhhhhhhhhh....eeeeee..hhhhhhhhhh.....eee..hhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhhh....hhhhhhhhhhhhh..............hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4lfm B   1 MIIAIGNDHIVTMQKIEISNMLKDMGYTVIDEGTYDTHRTHYPIYGKKVAEDVADGRADLGIVMCGTGIGISTAADKNEGIRAAMCDDVTSAVYAREQLNANVLGIGGAVVGVHLIQDIVKAYLDATYKETPENKKLIDKIDNIAKPNPDQKDNPHFFDAELEKWAEGVYHD 172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  


Chain C from PDB  Type:PROTEIN  Length:142
                                                                                                                                                                              
               SCOP domains d4lfmc_ C: automated matches                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhhh.....eeeee..hhhhhhhhh......eee..hhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhh....hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4lfm C   1 MDVIIGADKDGFAMKEQVKKYLEEHQYRVADVTPEPAEDFVESSLAVTKKLLNSDAHKAIMFDRYGVGSAMASNKVKGMVTAVVEEENTAHMTAEHNGAKAIAIGTGITGYDRALVIIQRYLDTEYAGGRHQIRLDMLEKMI 142
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140  


Chain D from PDB  Type:PROTEIN  Length:172
                                                                                                                                                                                                            
               SCOP domains d4lfmd_ D: automated matches                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhhhhh..eeee.........hhhhhhhhhhhhhhh....eeeeee..hhhhhhhhhh.....eee..hhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhhh....hhhhhhhhhhhhh..............hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4lfm D   1 MIIAIGNDHIVTMQKIEISNMLKDMGYTVIDEGTYDTHRTHYPIYGKKVAEDVADGRADLGIVMCGTGIGISTAADKNEGIRAAMCDDVTSAVYAREQLNANVLGIGGAVVGVHLIQDIVKAYLDATYKETPENKKLIDKIDNIAKPNPDQKDNPHFFDAELEKWAEGVYHD 172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4LFM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4LFM)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4LFM)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PSJ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4lfm)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4lfm
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  5.3.1.26
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4LFM)

(-) Related Entries Specified in the PDB File

4lfk 4lfl 4lfn