Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF AN UNUSUAL S-ADENOSYLMETHIONINE SYNTHETASE FROM CAMPYLOBACTER JEJUNI
 
Authors :  S. P. Zano, A. G. Pavlovsky, R. E. Viola
Date :  25 Jun 13  (Deposition) - 12 Feb 14  (Release) - 12 Nov 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Rossmann Fold, Transferase, Atp Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. P. Zano, A. G. Pavlovsky, R. E. Viola
Structure Of An Unusual S-Adenosylmethionine Synthetase Fro Campylobacter Jejuni.
Acta Crystallogr. , Sect. D V. 70 442 2014
PubMed-ID: 24531478  |  Reference-DOI: 10.1107/S139900471303023X

(-) Compounds

Molecule 1 - S-ADENOSYLMETHIONINE SYNTHETASE
    Chains: A, B
    EC Number: 2.5.1.6
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET101/D-TOPO
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 6-403
    Gene: CJE1239, METK
    Organism Scientific: CAMPYLOBACTER JEJUNI
    Organism Taxid: 195099
    Strain: RM1221

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4LE5)

(-) Sites  (0, 0)

(no "Site" information available for 4LE5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4LE5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4LE5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4LE5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4LE5)

(-) Exons   (0, 0)

(no "Exon" information available for 4LE5)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:388
                                                                                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains d4le5a1 A:1-106 automated matches                                                                         d4le5a2 A:118-243 automated matches                                                                                           d4le5a3 A:244-399 automated matches                                                                                                                          SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee...hhhhhhhhhhhhhhhhhhhhh...eeeeeeeee..eeeeeeeee.....hhhhhhhhhhhhhhhhh.............hhhhheeeeeee...........eeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeeee..hhhhhhh....eeeeeeee.......hhhhhhhhhhhhhhh.............eeee...............ee...........................hhhhhhhhhhhhhhhhhhhh....eeeeeeee........eeeee........hhhhhhhhhhhhh..hhhhhhhhhh.........hhhhhhhhh......hhhhh..hhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4le5 A   1 MYLFTSEVVSAGHPDKCADIIADTIVDILLKNDKNSRVASEVFVAGNKVVIGGEVKSNHKLSKADYDNLVKDVLKNIGYDGAGHFSKEQCLHPDEVDVMVFLNEQSGETGAGDQGIMFGFASCEAEEYMPAAISYARMLCDRVYAYAKANPHELGVDIKTQVTIDYGTKANFENCKPQSIHTIVVSAPCVESMKIEDLRSLVMKLILDSNLPKELFDPNKTRILINPTGKYVNHSSLHDSGLTGRKLIVDSFGGYSPIGGGAQSSKDYTKVDRSGLYAGRWLAKNIVAAGLAKKCIVQLSYAIGVAKPTSVSVDCMGTNTSVNDDVLSDFVMQNFSLTPNWIRDKFHLDKPSKETFLYADVAARGQVGQKDYPWEKLDALEQFKKLLK 399
                                    10        20        30        40        50        60        70        80        90       100     ||121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391        
                                                                                                                                   106|                                                                                                                                                                                                                                                                                         
                                                                                                                                    118                                                                                                                                                                                                                                                                                         


Chain B from PDB  Type:PROTEIN  Length:386
                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains d4le5b1 B:1-109 automated matches                                                                            d4le5b2 B:110-243 automated matches                                                                                       d4le5b3 B:244-398 automated matches                                                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee...hhhhhhhhhhhhhhhhhhhhh...eeeeeeeee..eeeeeeeee.....hhhhhhhhhhhhhhhhh.............hhhhheeee..eee........eeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeeee..hhhhhhh....eeeeeeee.......hhhhhhhhhhhhhhh.............eeee...............ee...........................hhhhhhhhhhhhhhhhhhhh....eeeeeeee........eeeee........hhhhhhhhhhhhh..hhhhhhhhhh.........hhhhhhhhh......hhhhh..hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4le5 B   1 MYLFTSEVVSAGHPDKCADIIADTIVDILLKNDKNSRVASEVFVAGNKVVIGGEVKSNHKLSKADYDNLVKDVLKNIGYDGAGHFSKEQCLHPDEVDVMVFLNEQSPDINQDQGIMFGFASCEAEEYMPAAISYARMLCDRVYAYAKANPHELGVDIKTQVTIDYGTKANFENCKPQSIHTIVVSAPCVESMKIEDLRSLVMKLILDSNLPKELFDPNKTRILINPTGKYVNHSSLHDSGLTGRKLIVDSFGGYSPIGGGAQSSKDYTKVDRSGLYAGRWLAKNIVAAGLAKKCIVQLSYAIGVAKPTSVSVDCMGTNTSVNDDVLSDFVMQNFSLTPNWIRDKFHLDKPSKETFLYADVAARGQVGQKDYPWEKLDALEQFKKLL 398
                                    10        20        30        40        50        60        70        80        90       100       110||     132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392      
                                                                                                                                        111|                                                                                                                                                                                                                                                                                  
                                                                                                                                         124
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4LE5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4LE5)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4LE5)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4le5)
 
  Sites
(no "Sites" information available for 4le5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4le5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4le5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.6
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4LE5)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4LE5)