Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  PRELIMINARY STRUCTURAL INVESTIGATIONS OF A MALARIAL PROTEIN SECRETION SYSTEM
 
Authors :  P. F. Egea
Date :  14 Jan 13  (Deposition) - 16 Apr 14  (Release) - 16 Dec 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Malaria, Aaa+ Atpase Clpb Chaperone, N-Terminal Cargo-Binding Domain, Protein Translocation And Unfolding, Parasitophorous Vacuole, Chaperone (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. P. Ahyoung, A. Koehl, D. Cascio, P. F. Egea
Structural Mapping Of The Clpb Atpases Of Plasmodium Falciparum: Targeting Protein Folding And Secretion For Antimalarial Drug Design.
Protein Sci. V. 24 1508 2015
PubMed-ID: 26130467  |  Reference-DOI: 10.1002/PRO.2739

(-) Compounds

Molecule 1 - MALARIAL CLPB2 ATPASE/HSP101 PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPCDF
    Expression System StrainC43(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GenePF11_0175, PF3D7_1116800
    Organism ScientificPLASMODIUM FALCIPARUM
    Organism Taxid36329
    Strain3D7

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4IRF)

(-) Sites  (0, 0)

(no "Site" information available for 4IRF)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4IRF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4IRF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4IRF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4IRF)

(-) Exons   (0, 0)

(no "Exon" information available for 4IRF)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:145
                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhh...eehhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh............eehhhhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhhhhh..hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4irf A   9 QGKYLNRTINILNAGKNIAKSYGHNKLKPIHILSALAKSDYGSTLFKENNVNAANLKEYIDIALEQTRAGAPLDNKSKIVNSAEVKETLALAEAAANKYKSPKVDVEHLLSGLSNDELVNEIFNEVYLTDEAIKAILKRKFEKTL 153
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148     

Chain B from PDB  Type:PROTEIN  Length:144
                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhh...eehhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh............eehhhhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhhhhh..hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4irf B   9 QGKYLNRTINILNAGKNIAKSYGHNKLKPIHILSALAKSDYGSTLFKENNVNAANLKEYIDIALEQTRAGAPLDNKSKIVNSAEVKETLALAEAAANKYKSPKVDVEHLLSGLSNDELVNEIFNEVYLTDEAIKAILKRKFEKT 152
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4IRF)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4IRF)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4IRF)

(-) Gene Ontology  (12, 12)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4irf)
 
  Sites
(no "Sites" information available for 4irf)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4irf)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4irf
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8IIJ8_PLAF7 | Q8IIJ8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8IIJ8_PLAF7 | Q8IIJ8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8IIJ8_PLAF7 | Q8IIJ84iod

(-) Related Entries Specified in the PDB File

4iod