Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF HELICOBACTER PYLORI CEUE (HP1561)
 
Authors :  M. M. Shaik, L. Cendron, G. Zanotti
Date :  05 Jan 13  (Deposition) - 08 Jan 14  (Release) - 26 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Heme-Binding Protein, Fe Transport, Abc Transporter Substrate Binding Protein, Periplasmic Space, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. M. Shaik, L. Cendron, M. Salamina, M. Ruzzene, G. Zanotti
Helicobacter Pylori Periplasmic Receptor Ceue (Hp1561) Modulates Its Nickel Affinity Via Organic Metallophores.
Mol. Microbiol. V. 91 724 2014
PubMed-ID: 24330328  |  Reference-DOI: 10.1111/MMI.12487

(-) Compounds

Molecule 1 - NICKEL (II) ABC TRANSPORTER, PERIPLASMIC NICKEL-BINDING PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET101-HP1561
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 32-333
    Gene: HPG27_1499
    Mutation: YES
    Organism Scientific: HELICOBACTER PYLORI
    Organism Taxid: 563041
    Strain: G27
    Synonym: CEUE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4INO)

(-) Sites  (0, 0)

(no "Site" information available for 4INO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4INO)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Leu A:49 -Pro A:50
2His A:103 -Ala A:104
3Leu B:49 -Pro B:50
4His B:103 -Ala B:104

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4INO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4INO)

(-) Exons   (0, 0)

(no "Exon" information available for 4INO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:302
                                                                                                                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..eeeeee.....eeee....hhhhhhhhhh.eeeee.hhhhhhhhhhhh.hhhhheee........hhhhhhhh...eeeee..hhhhhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh....eeeeee.....eee...hhhhhhhhhh.eee.hhhh....eee.hhhhhhhhh..eeee......hhhhhhhhhhhh.hhhhhh..eee.........hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ino A  34 QEVKVKDYFGEQTIKLPVSKIIYLGSFAEVPAMFHTWDRVVGISDYAFKSDIVKATLKDPERIKPMSSDHAAALNVELLKKLSPDLVVTFVGNPKAVEHAKKFGISFLSFQEKTIAEVMEDIDTQAKALEVDASKKLAKMQETLDFIAERLKGVKKKKGVELFHKANKISGHQALDSDILEKGGIDNFGLKYVKFGRADISVEKIVKENPEIIFIWWISPLSPEDVLNNPKFATIKAIKNKQVYKLPTMDIGGPRAPLISLFIALKAHPEAFKGVDINAIVKDYYKVVFDLNDAEVEPFLWH 335
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333  


Chain B from PDB  Type:PROTEIN  Length:302
                                                                                                                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..eeeeee.....eeee....hhhhhhhhhh.eeeee.hhhhhhhhhhhh.hhhhheee.......hhhhhhhhhh..eeeee..hhhhhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh....eeeeee.....eee...hhhhhhhhhh.eee.hhhh....eee.hhhhhhhhh..eeee......hhhhhhhhhhhh.hhhhhh..eee.........hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ino B  34 QEVKVKDYFGEQTIKLPVSKIIYLGSFAEVPAMFHTWDRVVGISDYAFKSDIVKATLKDPERIKPMSSDHAAALNVELLKKLSPDLVVTFVGNPKAVEHAKKFGISFLSFQEKTIAEVMEDIDTQAKALEVDASKKLAKMQETLDFIAERLKGVKKKKGVELFHKANKISGHQALDSDILEKGGIDNFGLKYVKFGRADISVEKIVKENPEIIFIWWISPLSPEDVLNNPKFATIKAIKNKQVYKLPTMDIGGPRAPLISLFIALKAHPEAFKGVDINAIVKDYYKVVFDLNDAEVEPFLWH 335
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4INO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4INO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4INO)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4INO)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4ino)
 
  Sites
(no "Sites" information available for 4ino)
 
  Cis Peptide Bonds
    His A:103 - Ala A:104   [ RasMol ]  
    His B:103 - Ala B:104   [ RasMol ]  
    Leu A:49 - Pro A:50   [ RasMol ]  
    Leu B:49 - Pro B:50   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ino
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B5Z9J2_HELPG | B5Z9J2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B5Z9J2_HELPG | B5Z9J2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        B5Z9J2_HELPG | B5Z9J2: 4inp 4ls3

(-) Related Entries Specified in the PDB File

4inp