Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF GLUTATHIONE S-TRANSFERASE MFLA_2116 (TARGET EFI-507160) FROM METHYLOBACILLUS FLAGELLATUS KT WITH GSH BOUND
 
Authors :  Y. Patskovsky, R. Toro, R. Bhosle, W. D. Zencheck, B. Hillerich, R. D. Se E. Washington, A. Scott Glenn, S. Chowdhury, B. Evans, J. Hammonds, H R. N. Armstrong, J. A. Gerlt, S. C. Almo, Enzyme Function Initiative
Date :  14 Aug 12  (Deposition) - 29 Aug 12  (Release) - 29 Aug 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Transferase-Like Protein, Transferase, Structural Genomics, Enzyme Function Initiative, Efi (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Patskovsky, R. Toro, R. Bhosle, W. D. Zencheck, B. Hillerich, R. D. Seidel, E. Washington, A. Scott Glenn, S. Chowdhury, B. Evans, J. Hammonds, H. J. Imker, R. N. Armstrong, J. A. Gerlt, S. C. Almo
Crystal Structure Of Glutathione S-Transferase Mfla_2116 (Target Efi-507160) From Methylobacillus Flagellatus Kt Wit Gsh Bound
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - GLUTATHIONE S-TRANSFERASE-LIKE PROTEIN
    Chains: A, B, C, D
    Engineered: YES
    Gene: MFLA_2116
    Organism Common: BACTERIA
    Organism Scientific: METHYLOBACILLUS FLAGELLATUS
    Organism Taxid: 265072
    Strain: KT

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1GSH4Ligand/IonGLUTATHIONE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1GSH2Ligand/IonGLUTATHIONE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1GSH2Ligand/IonGLUTATHIONE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR A:8 , SER A:9 , PRO A:10 , TYR A:11 , LEU A:33 , LYS A:48 , ILE A:49 , PRO A:50 , ASP A:62 , SER A:63 , TYR A:165 , ARG A:169BINDING SITE FOR RESIDUE GSH A 301
2AC2SOFTWARELYS A:125 , LYS A:129 , SER B:9 , TYR B:11 , LYS B:48 , ILE B:49 , PRO B:50 , ASP B:62 , SER B:63 , HOH B:403BINDING SITE FOR RESIDUE GSH B 301
3AC3SOFTWARESER C:9 , TYR C:11 , GLY C:47 , LYS C:48 , ILE C:49 , PRO C:50 , ASP C:62 , SER C:63 , HOH C:401 , HOH C:415 , HOH C:417 , LYS D:129BINDING SITE FOR RESIDUE GSH C 301
4AC4SOFTWARELYS C:125 , LYS C:129 , SER D:9 , GLY D:47 , LYS D:48 , ILE D:49 , PRO D:50 , ASP D:62 , SER D:63 , HOH D:406 , HOH D:407 , HOH D:417 , HOH D:418BINDING SITE FOR RESIDUE GSH D 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4GLT)

(-) Cis Peptide Bonds  (9, 9)

Asymmetric Unit
No.Residues
1Ile A:49 -Pro A:50
2Tyr A:61 -Asp A:62
3Cys B:38 -Pro B:39
4Ile B:49 -Pro B:50
5Tyr B:61 -Asp B:62
6Ile C:49 -Pro C:50
7Tyr C:61 -Asp C:62
8Ile D:49 -Pro D:50
9Tyr D:61 -Asp D:62

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4GLT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4GLT)

(-) Exons   (0, 0)

(no "Exon" information available for 4GLT)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:208
                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee...hhhhhhhhhhhhhhh...eeee........hhhhh.......eee.....ee.hhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4glt A  -5 NLYFQSMKLLYSNTSPYARKVRVVAAEKRIDVDMVLVVLADPECPVADHNPLGKIPVLILPDGESLYDSRVIVEYLDHRTPVAHLIPQDHTAKIAVRRWEALADGVTDAAVAAVMEGRRPEGMQDSAVIEKQLNKVERGLRRMDQDLEKRKWCVNESFSLADIAVGCMLGYLELRYQHLDWKQQYPNLARHYAAMMKRASFKDTAPVI 202
                                     4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194        


Chain B from PDB  Type:PROTEIN  Length:203
                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...hhhhhhhhhhhhhh....eeee........hhhhhh......eee.....ee.hhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4glt B   0 SMKLLYSNTSPYARKVRVVAAEKRIDVDMVLVVLADPECPVADHNPLGKIPVLILPDGESLYDSRVIVEYLDHRTPVAHLIPQDHTAKIAVRRWEALADGVTDAAVAAVMEGRRPEGMQDSAVIEKQLNKVERGLRRMDQDLEKRKWCVNESFSLADIAVGCMLGYLELRYQHLDWKQQYPNLARHYAAMMKRASFKDTAPVI 202
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199   


Chain C from PDB  Type:PROTEIN  Length:202
                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhh..eeeee........hhhhhh......eee.....ee.hhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4glt C   0 SMKLLYSNTSPYARKVRVVAAEKRIDVDMVLVVLADPECPVADHNPLGKIPVLILPDGESLYDSRVIVEYLDHRTPVAHLIPQDHTAKIAVRRWEALADGVTDAAVAAVMEGRRPEGMQDSAVIEKQLNKVERGLRRMDQDLEKRKWCVNESFSLADIAVGCMLGYLELRYQHLDWKQQYPNLARHYAAMMKRASFKDTAPV 201
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199  


Chain D from PDB  Type:PROTEIN  Length:208
                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee...hhhhhhhhhhhhhh....eeee........hhhhhh......eee.....ee.hhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4glt D  -5 NLYFQSMKLLYSNTSPYARKVRVVAAEKRIDVDMVLVVLADPECPVADHNPLGKIPVLILPDGESLYDSRVIVEYLDHRTPVAHLIPQDHTAKIAVRRWEALADGVTDAAVAAVMEGRRPEGMQDSAVIEKQLNKVERGLRRMDQDLEKRKWCVNESFSLADIAVGCMLGYLELRYQHLDWKQQYPNLARHYAAMMKRASFKDTAPVI 202
                                     4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4GLT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4GLT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4GLT)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GSH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Cys B:38 - Pro B:39   [ RasMol ]  
    Ile A:49 - Pro A:50   [ RasMol ]  
    Ile B:49 - Pro B:50   [ RasMol ]  
    Ile C:49 - Pro C:50   [ RasMol ]  
    Ile D:49 - Pro D:50   [ RasMol ]  
    Tyr A:61 - Asp A:62   [ RasMol ]  
    Tyr B:61 - Asp B:62   [ RasMol ]  
    Tyr C:61 - Asp C:62   [ RasMol ]  
    Tyr D:61 - Asp D:62   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4glt
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q1GZF4_METFK | Q1GZF4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q1GZF4_METFK | Q1GZF4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4GLT)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4GLT)