Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CYP105N1 FROM STREPTOMYCES COELICOLOR: A CYTOCHROME P450 OXIDASE IN THE COELIBACTIN SIDEROPHORE BIOSYNTHETIC PATHWAY
 
Authors :  M. K. Hong, Y. R. Lim, J. K. Kim, D. H. Kim, L. W. Kang
Date :  03 Jul 12  (Deposition) - 14 Nov 12  (Release) - 14 Nov 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  P450, Cyp105N1, Streptomyces Coelicolor, Coelibactin, Estradiol, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. R. Lim, M. K. Hong, J. K. Kim, T. T. Doan, D. H. Kim, C. H. Yun, Y. J. Chun, L. W. Kang, D. Kim
Crystal Structure Of Cytochrome P450 Cyp105N1 From Streptomyces Coelicolor, An Oxidase In The Coelibactin Siderophore Biosynthetic Pathway
Arch. Biochem. Biophys. V. 528 111 2012
PubMed-ID: 23000034  |  Reference-DOI: 10.1016/J.ABB.2012.09.001

(-) Compounds

Molecule 1 - PUTATIVE CYTOCHROME P450
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: SCO7686
    Organism Scientific: STREPTOMYCES COELICOLOR
    Organism Taxid: 100226
    Strain: A3(2)

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1HEM2Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE A:99 , HIS A:107 , ARG A:111 , THR A:246 , ALA A:249 , GLY A:250 , THR A:253 , THR A:254 , ALA A:296 , ILE A:299 , PRO A:300 , ARG A:302 , LEU A:325 , ALA A:352 , PHE A:353 , GLY A:354 , HIS A:358 , GLN A:359 , CYS A:360 , VAL A:361 , GLY A:362 , ALA A:366BINDING SITE FOR RESIDUE HEM A 501
2AC2SOFTWAREILE B:100 , ARG B:111 , PHE B:118 , LEU B:166 , GLY B:250 , THR B:253 , THR B:254 , ILE B:299 , PRO B:300 , ARG B:302 , ALA B:352 , PHE B:353 , GLY B:354 , HIS B:358 , CYS B:360 , VAL B:361 , ALA B:366BINDING SITE FOR RESIDUE HEM B 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4FXB)

(-) Cis Peptide Bonds  (12, 12)

Asymmetric Unit
No.Residues
1Gln A:24 -Arg A:25
2Pro A:28 -Phe A:29
3Ala A:30 -Ala A:31
4Arg A:78 -Arg A:79
5Glu A:89 -Gln A:90
6Ala A:92 -Gly A:93
7Ala A:104 -Pro A:105
8Ser A:189 -Thr A:190
9Gly B:145 -Gly B:146
10His B:172 -Asp B:173
11Val B:230 -Pro B:231
12Pro B:231 -Gly B:232

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4FXB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4FXB)

(-) Exons   (0, 0)

(no "Exon" information available for 4FXB)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:390
                                                                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains d4fxba_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ................hhhhhhhh..eeeee.....eeeee.hhhhhhhhhh........................hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eehhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......ee................eeeehhhhhhh...............................hhhhhhhhhhhhhhhhhhhh...ee..hhhhh..............eee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4fxb A  18 PRDFPIQRGCPFAAPAEYAALRTDDPVARVTLPTRREAWVVTRYDDVRELLSDPRVSADIRRPGFPGEQEAGARFRPFIRTDAPEHTRYRRMLLPAFTVRRVRAMRPAVQARVDEILDGMLAAGGPVDLVSAYANAVSTSVICELLGIPRHDLEFFRDVTRISGSRNSTAEQVSEALGGLFGLLGGLVAERREEPRDDLISKLVTDHLVPGNVTTEQLLSTLGITINAGRETTTSMIALSTLLLLDRPELPAELRKDPDLMPAAVDELLRVLSVADSIPLRVAAEDIELSGRTVPADDGVIALLAGANHDPEQFDDPERVDFHRTDNHHVAFGYGVHQCVGQHLARLELEVALETLLRRVPTLRLAGERDQVVVKHDSATFGLEELMVTW 411
                                    27        37        47        57        67        77     || 91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411
                                                                                            83|                                                                                                                                                                                                                                                                                                                                   
                                                                                             88                                                                                                                                                                                                                                                                                                                                   


Chain B from PDB  Type:PROTEIN  Length:370
                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains d4fxbb_ B: automated matches                                                                                                                                                                                                                                                                                                                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhh..eeeeee...eeeeee.hhhhhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eehhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh......eee....ee....ee....eeeehhhhhh....................hhhhh.......hhhhhhhhhhhhhhhhhhh..........................ee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4fxb B  18 PRDFPIFAAPAEYAALRTDDPVARVTLPTRREAWVVTRYDDVRELLSDPRVSADIRRPGFRPFIRTDAPEHTRYRRMLLPAFTVRRVRAMRPAVQARVDEILDGMLAAGGPVDLVSAYANAVSTSVICELLGIPRHDLEFFRDVTRISGSRAEQVSEALGGLFGLLGGLVAERREEPRDDLISKLVTDHLVPGNVTTEQLLSTLGITINAGRETTTSMIALSTLLLLDRPELPAELRKDPDLMPAAVDELLRVLSVADSIPLRVAAEDIELSGRTVPADDGVIALLAGANHDPEQFDDPERVDFHRTDNHHVAFGYGVHQCVGQHLARLELEVALETLLRRVPTLRLAERDQVVVKHDSATFGLEELMVT 410
                                 || 32        42        52        62        72        82|      106       116       126       136       146       156       166       176       186||     199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       390       400       410
                                23|                                                   82|                                                                                       187|                                                                                                                                                                                                 387|                     
                                 29                                                    97                                                                                        191                                                                                                                                                                                                  389
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4FXB)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4FXB)

(-) Gene Ontology  (11, 11)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:104 - Pro A:105   [ RasMol ]  
    Ala A:30 - Ala A:31   [ RasMol ]  
    Ala A:92 - Gly A:93   [ RasMol ]  
    Arg A:78 - Arg A:79   [ RasMol ]  
    Gln A:24 - Arg A:25   [ RasMol ]  
    Glu A:89 - Gln A:90   [ RasMol ]  
    Gly B:145 - Gly B:146   [ RasMol ]  
    His B:172 - Asp B:173   [ RasMol ]  
    Pro A:28 - Phe A:29   [ RasMol ]  
    Pro B:231 - Gly B:232   [ RasMol ]  
    Ser A:189 - Thr A:190   [ RasMol ]  
    Val B:230 - Pro B:231   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4fxb
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9EWP1_STRCO | Q9EWP1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9EWP1_STRCO | Q9EWP1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q9EWP1_STRCO | Q9EWP1: 3tyw

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4FXB)