Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  X-RAY CRYSTAL STRUCTURE OF ALLOPHYCOCYANIN FROM SYNECHOCOCCUS ELONGATUS PCC 7942
 
Authors :  A. Marx, N. Adir
Date :  05 May 12  (Deposition) - 06 Mar 13  (Release) - 06 Mar 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  Component Of The Phycobilisome, Photosynthetic Antenna Complex, Photosynthesis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Marx, N. Adir
Allophycocyanin And Phycocyanin Crystal Structures Reveal Facets Of Phycobilisome Assembly.
Biochim. Biophys. Acta V. 1827 311 2013
PubMed-ID: 23201474  |  Reference-DOI: 10.1016/J.BBABIO.2012.11.006

(-) Compounds

Molecule 1 - ALLOPHYCOCYANIN ALPHA CHAIN
    Chains: A, C, E
    Organism Scientific: SYNECHOCOCCUS ELONGATUS
    Organism Taxid: 1140
    Strain: PCC 7942
 
Molecule 2 - ALLOPHYCOCYANIN, BETA SUBUNIT
    Chains: B, D, F
    Organism Scientific: SYNECHOCOCCUS ELONGATUS
    Organism Taxid: 1140
    Strain: PCC 7942

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit : ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 9)

Asymmetric/Biological Unit (2, 9)
No.NameCountTypeFull Name
1CYC6Ligand/IonPHYCOCYANOBILIN
2MEN3Mod. Amino AcidN-METHYL ASPARAGINE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:59 , VAL A:66 , ASN A:72 , ALA A:75 , MET A:80 , THR A:83 , CYS A:84 , ARG A:86 , ASP A:87 , LEU A:88 , TYR A:91 , ILE A:110 , GLY A:111 , MET A:118 , LEU A:122 , THR A:124 , ALA A:128 , LEU F:61 , TYR F:62 , THR F:67 , TYR F:76 , THR F:77 , THR F:78BINDING SITE FOR RESIDUE CYC A 201
2AC2SOFTWAREILE B:66 , MEN B:72 , MET B:75 , ARG B:79 , ARG B:80 , CYS B:84 , ARG B:86 , ASP B:87 , LEU B:88 , TYR B:90 , ARG B:110 , VAL B:111 , LEU B:122 , VAL B:124 , PRO B:125 , ALA B:128 , THR B:129 , HOH B:330BINDING SITE FOR RESIDUE CYC B 201
3AC3SOFTWARETHR B:67 , TYR B:76 , THR B:77 , THR B:78 , VAL C:66 , ASN C:72 , ALA C:75 , THR C:83 , CYS C:84 , ARG C:86 , ASP C:87 , LEU C:88 , TYR C:90 , TYR C:91 , ILE C:110 , MET C:118 , LEU C:122 , THR C:124 , ALA C:128 , SER F:22BINDING SITE FOR RESIDUE CYC C 201
4AC4SOFTWAREMEN D:72 , MET D:75 , ARG D:79 , ARG D:80 , CYS D:84 , ARG D:86 , ASP D:87 , LEU D:88 , TYR D:90 , TYR D:94 , ARG D:110 , TYR D:119 , THR D:129 , HOH D:309BINDING SITE FOR RESIDUE CYC D 201
5AC5SOFTWARELEU D:61 , TYR D:62 , THR D:67 , TYR D:76 , THR D:77 , VAL E:66 , ASN E:72 , ALA E:75 , MET E:80 , THR E:83 , CYS E:84 , ARG E:86 , ASP E:87 , LEU E:88 , TYR E:90 , TYR E:91 , ILE E:110 , MET E:118 , ALA E:128 , HOH E:321BINDING SITE FOR RESIDUE CYC E 201
6AC6SOFTWARELEU F:60 , ILE F:66 , MEN F:72 , MET F:75 , ARG F:80 , ALA F:83 , CYS F:84 , ARG F:86 , ASP F:87 , ARG F:110 , VAL F:124 , PRO F:125 , ALA F:128 , THR F:129 , HOH F:312BINDING SITE FOR RESIDUE CYC F 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4F0U)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4F0U)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4F0U)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4F0U)

(-) Exons   (0, 0)

(no "Exon" information available for 4F0U)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:160
                                                                                                                                                                                                
               SCOP domains d4f0ua_ A: automated matches                                                                                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f0u A   3 SIVSKSIVNADAEARYLSPGELERIKTFVVGGDRRLRIAQTIAESRERIVKQAGNQLFQKRPDVVSPGGNAYGEDMTATCLRDLDYYLRLVTYGVVSGDITPIEEIGIVGVREMYKSLGTPIEAVAEGVRELKSAATALLTGEDADEAGAYFDYVIGALS 174
                                    12        22        32        42        52        62        72|       84        94       104       114       124       134       144     ||164       174
                                                                                                72|                                                                        150|             
                                                                                                 75                                                                         161             


Chain B from PDB  Type:PROTEIN  Length:161
                                                                                                                                                                                                 
               SCOP domains d4f0ub_ B: automated matches                                                                                                                                      SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f0u B   1 MQDAITAVINASDVQGKYLDSSALDRLKSYFQSGELRVRAAATISANSALIVKEAVAKSLLYSDITRPGGnMYTTRRYAACIRDLEYYLRYATYAMLAGDTSILDERVLNGLKETYNSLGVPIGATVQAIQAIKEVTASLVGPDAGREMGVYLDYISSGLS 174
                                    10        20        30        40        50        60 ||     71||      83        93       103       113       123       133       143      |163       173 
                                                                                        62|      72-MEN                                                                     150|             
                                                                                         64       75                                                                         161             


Chain C from PDB  Type:PROTEIN  Length:160
                                                                                                                                                                                                
               SCOP domains d4f0uc_ C: automated matches                                                                                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f0u C   3 SIVSKSIVNADAEARYLSPGELERIKTFVVGGDRRLRIAQTIAESRERIVKQAGNQLFQKRPDVVSPGGNAYGEDMTATCLRDLDYYLRLVTYGVVSGDITPIEEIGIVGVREMYKSLGTPIEAVAEGVRELKSAATALLTGEDADEAGAYFDYVIGALS 174
                                    12        22        32        42        52        62        72|       84        94       104       114       124       134       144     ||164       174
                                                                                                72|                                                                        150|             
                                                                                                 75                                                                         161             


Chain D from PDB  Type:PROTEIN  Length:161
                                                                                                                                                                                                 
               SCOP domains d4f0ud_ D: automated matches                                                                                                                                      SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f0u D   1 MQDAITAVINASDVQGKYLDSSALDRLKSYFQSGELRVRAAATISANSALIVKEAVAKSLLYSDITRPGGnMYTTRRYAACIRDLEYYLRYATYAMLAGDTSILDERVLNGLKETYNSLGVPIGATVQAIQAIKEVTASLVGPDAGREMGVYLDYISSGLS 174
                                    10        20        30        40        50        60 ||     71||      83        93       103       113       123       133       143      |163       173 
                                                                                        62|      72-MEN                                                                     150|             
                                                                                         64       75                                                                         161             


Chain E from PDB  Type:PROTEIN  Length:160
                                                                                                                                                                                                
               SCOP domains d4f0ue_ E: automated matches                                                                                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f0u E   3 SIVSKSIVNADAEARYLSPGELERIKTFVVGGDRRLRIAQTIAESRERIVKQAGNQLFQKRPDVVSPGGNAYGEDMTATCLRDLDYYLRLVTYGVVSGDITPIEEIGIVGVREMYKSLGTPIEAVAEGVRELKSAATALLTGEDADEAGAYFDYVIGALS 174
                                    12        22        32        42        52        62        72|       84        94       104       114       124       134       144     ||164       174
                                                                                                72|                                                                        150|             
                                                                                                 75                                                                         161             


Chain F from PDB  Type:PROTEIN  Length:161
                                                                                                                                                                                                 
               SCOP domains d4f0uf_ F: automated matches                                                                                                                                      SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4f0u F   1 MQDAITAVINASDVQGKYLDSSALDRLKSYFQSGELRVRAAATISANSALIVKEAVAKSLLYSDITRPGGnMYTTRRYAACIRDLEYYLRYATYAMLAGDTSILDERVLNGLKETYNSLGVPIGATVQAIQAIKEVTASLVGPDAGREMGVYLDYISSGLS 174
                                    10        20        30        40        50        60 ||     71||      83        93       103       113       123       133       143      |163       173 
                                                                                        62|      72-MEN                                                                     150|             
                                                                                         64       75                                                                         161
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 6)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4F0U)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4F0U)

(-) Gene Ontology  (4, 8)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CYC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MEN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4f0u)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4f0u
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q31RG0_SYNE7 | Q31RG0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q31RG1_SYNE7 | Q31RG1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q31RG0_SYNE7 | Q31RG0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q31RG1_SYNE7 | Q31RG1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4F0U)

(-) Related Entries Specified in the PDB File

4f0t