Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  MULTICOPPER OXIDASE CUEO (CITRATE BUFFER)
 
Authors :  H. Komori, K. Kataoka, T. Sakurai, Y. Higuchi
Date :  29 Mar 12  (Deposition) - 22 May 13  (Release) - 03 Aug 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A
Keywords :  Multicopper Oxidase, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Komori, K. Kataoka, S. Tanaka, N. Matsuda, Y. Higuchi, T. Sakurai
Exogenous Acetate Ion Reaches The Type Ii Copper Centre In Cueo Through The Water-Excretion Channel And Potentially Affects The Enzymatic Activity.
Acta Crystallogr. , Sect. F V. 72 558 2016
PubMed-ID: 27380373  |  Reference-DOI: 10.1107/S2053230X16009237

(-) Compounds

Molecule 1 - BLUE COPPER OXIDASE CUEO
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: CUEO, YACK, B0123, JW0119
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 83333
    Strain: K12
    Synonym: COPPER EFFLUX OXIDASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 7)

Asymmetric/Biological Unit (4, 7)
No.NameCountTypeFull Name
1CIT1Ligand/IonCITRIC ACID
2CU4Ligand/IonCOPPER (II) ION
3O1Ligand/IonOXYGEN ATOM
4OH1Ligand/IonHYDROXIDE ION

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:443 , CYS A:500 , HIS A:505 , MET A:510BINDING SITE FOR RESIDUE CU A 1001
2AC2SOFTWAREHIS A:103 , HIS A:141 , HIS A:501 , CU A:1003 , OH A:1005 , O A:1006BINDING SITE FOR RESIDUE CU A 1002
3AC3SOFTWAREHIS A:143 , HIS A:446 , HIS A:448 , HIS A:499 , CU A:1002 , CU A:1004 , OH A:1005 , O A:1006BINDING SITE FOR RESIDUE CU A 1003
4AC4SOFTWAREHIS A:101 , HIS A:103 , HIS A:446 , HIS A:448 , CU A:1003 , O A:1006 , HOH A:1102BINDING SITE FOR RESIDUE CU A 1004
5AC5SOFTWAREHIS A:141 , HIS A:143 , HIS A:499 , HIS A:501 , CU A:1002 , CU A:1003 , O A:1006 , HOH A:1101BINDING SITE FOR RESIDUE OH A 1005
6AC6SOFTWAREHIS A:101 , HIS A:103 , HIS A:141 , HIS A:446 , HIS A:448 , CU A:1002 , CU A:1003 , CU A:1004 , OH A:1005BINDING SITE FOR RESIDUE O A 1006
7AC7SOFTWAREARG A:82 , PRO A:134 , LYS A:485 , ASN A:487 , HOH A:1116 , HOH A:1257 , HOH A:1322 , HOH A:1328 , HOH A:1484 , HOH A:1512BINDING SITE FOR RESIDUE CIT A 1007

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4EF3)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ala A:308 -Pro A:309

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4EF3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4EF3)

(-) Exons   (0, 0)

(no "Exon" information available for 4EF3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:466
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains d4ef3a1 A:30-170 multi-copper oxidase CueO                                                                                                   d4ef3a2 A:171-335 multi-copper oxidase CueO                                                                                                                          d4ef3a3 A:336-517 multi-copper oxidase CueO                                                                                                                      SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........ee......eeeeeeeeeeeee..eeeeeeee.......eeeee...eeeeeeee........eee....hhhhhh..........eeeeeee.....eeeeee.....hhhhhhhh...eeeeeehhhhhhh.........eeeeeeeee............hhhhhhhh....eeee......eeeee.eeeeeeeee......eeeee.....eeeeee..eeeeeeeee..eee....eeeeeeee.....eeeee................eeeeeeeee.........................eeeeeeeehhhhhhhhhhhhhhhhhhhhhh...hhhh.eee...........eee.....eeeeee.......eeeee.....eeee......hhhhh....eeee...eeeeee......hhhhheeeee.hhhhhhh..eeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ef3 A  30 ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVG 517
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379|      411       421       431       441       451       461       471       481       491       501       511      
                                                                                                                                                                                                                                                                                                                                                                                       379|                                                                                                                   
                                                                                                                                                                                                                                                                                                                                                                                        402
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4EF3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4EF3)

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CIT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    O  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:308 - Pro A:309   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ef3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CUEO_ECOLI | P36649
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CUEO_ECOLI | P36649
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CUEO_ECOLI | P36649: 1kv7 1n68 1pf3 2fqd 2fqe 2fqf 2fqg 2yxv 2yxw 3nsc 3nsd 3nsf 3nsy 3nt0 3od3 3pau 3pav 3qqx 3uaa 3uab 3uac 3uad 3uae 4e9q 4e9r 4e9s 4e9t 4hak 4hal 4ner 5b7e 5b7f 5b7m

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4EF3)