Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE TOXOPLASMA GONDII TS-DHFR
 
Authors :  H. Sharma, K. S. Anderson
Date :  26 Mar 12  (Deposition) - 02 Oct 13  (Release) - 04 Feb 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.52
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Bifunctional, Transferase, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Sharma, M. J. Landau, M. A. Vargo, K. A. Spasov, K. S. Anderson
First Three-Dimensional Structure Of Toxoplasma Gondii Thymidylate Synthase-Dihydrofolate Reductase: Insights For Catalysis, Interdomain Interactions, And Substrate Channeling.
Biochemistry V. 52 7305 2013
PubMed-ID: 24053355  |  Reference-DOI: 10.1021/BI400576T

(-) Compounds

Molecule 1 - BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    Chains: A, B
    EC Number: 1.5.1.3, 2.1.1.45
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET15B
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: DRTS
    Organism Scientific: TOXOPLASMA GONDII
    Organism Taxid: 5811
    Strain: K-12
    Synonym: DHFR-TS, DIHYDROFOLATE REDUCTASE, THYMIDYLATE SYNTHASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 8)

Asymmetric/Biological Unit (4, 8)
No.NameCountTypeFull Name
1CB32Ligand/Ion10-PROPARGYL-5,8-DIDEAZAFOLIC ACID
2FOL2Ligand/IonFOLIC ACID
3NDP2Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE
4UMP2Ligand/Ion2'-DEOXYURIDINE 5'-MONOPHOSPHATE

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:344 , TYR A:429 , CYS A:489 , HIS A:490 , GLN A:509 , ARG A:510 , SER A:511 , CYS A:512 , ASP A:513 , ASN A:521 , HIS A:551 , TYR A:553 , CB3 A:702 , ARG B:469 , ARG B:470BINDING SITE FOR RESIDUE UMP A 701
2AC2SOFTWAREGLU A:381 , ILE A:402 , TRP A:403 , ASN A:406 , ASP A:513 , GLY A:517 , PHE A:520 , ASN A:521 , TYR A:553 , ARG A:603 , ALA A:609 , UMP A:701BINDING SITE FOR RESIDUE CB3 A 702
3AC3SOFTWAREVAL A:8 , ALA A:10 , ASP A:31 , PHE A:32 , PHE A:35 , MET A:87 , PHE A:91 , ARG A:97 , VAL A:151 , THR A:172 , NDP A:704BINDING SITE FOR RESIDUE FOL A 703
4AC4SOFTWAREALA A:10 , ILE A:17 , GLY A:18 , ILE A:19 , ASN A:21 , GLY A:22 , LEU A:23 , TRP A:25 , GLY A:80 , ARG A:81 , LYS A:82 , THR A:83 , SER A:86 , VAL A:102 , SER A:103 , SER A:104 , GLY A:153 , ALA A:154 , GLY A:155 , LEU A:156 , TYR A:157 , VAL A:182 , FOL A:703BINDING SITE FOR RESIDUE NDP A 704
5AC5SOFTWAREARG A:469 , ARG A:470 , ARG B:344 , CYS B:489 , HIS B:490 , GLN B:509 , ARG B:510 , SER B:511 , CYS B:512 , ASP B:513 , ASN B:521 , HIS B:551 , TYR B:553 , CB3 B:702BINDING SITE FOR RESIDUE UMP B 701
6AC6SOFTWAREPHE B:374 , GLU B:381 , ILE B:402 , ASN B:406 , ASP B:513 , LEU B:516 , GLY B:517 , PHE B:520 , ASN B:521 , TYR B:553 , MET B:608 , ALA B:609 , UMP B:701BINDING SITE FOR RESIDUE CB3 B 702
7AC7SOFTWAREVAL B:8 , VAL B:9 , ALA B:10 , LEU B:23 , ASP B:31 , PHE B:32 , PHE B:35 , SER B:36 , MET B:87 , PHE B:91 , LEU B:94 , ARG B:97 , VAL B:151 , THR B:172 , NDP B:704BINDING SITE FOR RESIDUE FOL B 703
8AC8SOFTWAREVAL B:8 , VAL B:9 , ALA B:10 , ILE B:17 , GLY B:18 , ILE B:19 , ASN B:21 , GLY B:22 , LEU B:23 , TRP B:25 , GLY B:80 , ARG B:81 , LYS B:82 , THR B:83 , SER B:86 , VAL B:102 , SER B:103 , SER B:104 , SER B:105 , GLY B:153 , ALA B:154 , GLY B:155 , LEU B:156 , ALA B:159 , VAL B:182 , FOL B:703BINDING SITE FOR RESIDUE NDP B 704

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4ECK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4ECK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ECK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ECK)

(-) Exons   (0, 0)

(no "Exon" information available for 4ECK)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:498
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eee.eee....eee.........hhhhhhhhhhhhh.....eeeeeehhhhhh..........eeeeee..................ee..hhhhhhhh.........eee...hhhhhhhh..eeeeeeeee.......ee..........eeeeee...eee..eeeeeeeeee...hhhhhhhhh.....................hhhhhhhhhhhhhhheee.......eee...eeeeee.............hhhhhhhhhhhhhhh...hhhhhh.....hhhhhhhhhhhh.............hhhhhhhhh................hhhhhhhhhhh..........................eeeeeeee.....eeeeeeeeeee..hhhhhhhhhhhhhhhhhhhhh.....eeeeeeeeeeee..hhhhhhhhh........eeee................eeee.............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4eck A   3 KPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAKEGQQRVRVCASLPAALSLEEYKDSVDQIFVVGAGLYEAALSGVASHLYITRVAREFPCDVFFPAPGDDILTYRPIFISKTFSDNGVPYDFVVLEKRSSAAAIAPVLAWMDEDRELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV 610
                                    12        22        32        42 ||     81        91       101       111 |||   125       135|||    147   ||  158   ||  169       179      |190  ||   232       242       285       295   ||||312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602        
                                                                    44|                                    113||              136||        151|      162|                   186|  193|                      251|           299|||                                                                                                                                                                                                                                                                                                             
                                                                     74                                     115|               138|         153       164                    188   226                       285            301||                                                                                                                                                                                                                                                                                                             
                                                                                                             119                140                                                                                          302|                                                                                                                                                                                                                                                                                                             
                                                                                                                                                                                                                              309                                                                                                                                                                                                                                                                                                             


Chain B from PDB  Type:PROTEIN  Length:498
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeee....eee.........hhhhhhhhhhh........eeeeehhhhh............eeeee.................eeee.hhhhhhh..........eee.....hhhhhh...eeeeeeee.......ee..........ee.......eee..eeeeeeeeee......hhhhhhhhhh.................hhhhhhhhhhhhhhheee.......eee....eeeee.............hhhhhhhhhhhhhhh..hhhhhhh..........hhhhhhh.............hhhhhhhh.................hhhhhhhhhhhhh......eee.....hhhhh.....eeeeeeee.....eeeeeeeeeee..hhhhhhhhhhhhhhhhhhhhh.....eeeeeeeeeeee.hhhhhhhhh.........eeee................eeee.............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4eck B   3 KPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAKEGQQRVRVCASLPAALSLEEYKDSVDQIFVVGAGLYEAALSGVASHLYITRVAREFPCDVFFPAPGDDILTYRPIFISKTFSDNGVPYDFVVLEKRSSAAAIAPVLAWMDEDRELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV 610
                                    12        22        32        42 ||     81        91       101       111 |||   125       135|||    147   ||  158   ||  169       179      |190  ||   232       242       285       295   ||||312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602        
                                                                    44|                                    113||              136||        151|      162|                   186|  193|                      251|           299|||                                                                                                                                                                                                                                                                                                             
                                                                     74                                     115|               138|         153       164                    188   226                       285            301||                                                                                                                                                                                                                                                                                                             
                                                                                                             119                140                                                                                          302|                                                                                                                                                                                                                                                                                                             
                                                                                                                                                                                                                              309
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4ECK)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ECK)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ECK)

(-) Gene Ontology  (14, 14)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CB3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UMP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4eck)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4eck
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DRTS_TOXGO | Q07422
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.5.1.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  2.1.1.45
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  DRTS_TOXGO | Q07422
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DRTS_TOXGO | Q07422: 4eil 4ky4 4kya 5t0l

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4ECK)