|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 8)| Asymmetric/Biological Unit (3, 8) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 4DZG) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 4DZG) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 4DZG) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 4DZG) |
Exons (0, 0)| (no "Exon" information available for 4DZG) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:114 aligned with A0KEJ7_AERHH | A0KEJ7 from UniProtKB/TrEMBL Length:134 Alignment length:114 30 40 50 60 70 80 90 100 110 120 130 A0KEJ7_AERHH 21 ADKITTVPVQFAKGAHSAQLKGSFTGYDTIHYTLVAKAGQTMTVKIGGSSNANFNVFAPGAQPGQAEAIGRNDGDGQWQGALPASGKYLIQVYQMRASARRGEQVPHTLAVSIQ 134 SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------ Transcript 4dzg A 21 aDkITTVPVQFAkGAHSAQLkGSFTGYDTIHYTLVAkAGQTMTVkIGGSSNANFNVFAPGAQPGQAEAIGRNDGDGQWQGALPASGkYLIQVYQMRASARRGEQVPHSLAVSIQ 134 | | 30 | 40| 50 | 60 | 70 80 90 100 |110 120 130 | | 33-MLY 41-MLY 57-MLY 65-MLY 107-MLY 21-MAA 23-MLY
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 4DZG) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 4DZG) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 4DZG) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 4DZG)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|