4DQ8 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF ACETATE KINASE ACKA FROM MYCOBACTERIUM MARINUM

Authors :   Seattle Structural Genomics Center For Infectious Disease (S

Date :   15 Feb 12 (Deposition) - 22 Feb 12 (Release) - 22 Apr 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.25

Chains :   Asym./Biol. Unit : A,B

Keywords :   Acetokinase, Mycobacterium, Atp-Dependent, Metabolic Intermediate Biosynthesis, Acetyl-Coa Biosynthesis, Cytoplasmic, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. Baugh, I. Phan, D. W. Begley, M. C. Clifton, B. Armour, D. M. Dranow, B. M. Taylor, M. M. Muruthi, J. Abendroth, J. W. Fairman, D. Fox, S. H. Dieterich, B. L. Staker, A. S. Gardberg, R. Choi, S. N. Hewitt, A. J. Napuli, J. Myers, L. K. Barrett, Y. Zhang, M. Ferrell, E. Mundt, K. Thompkins, N. Tran, S. Lyons-Abbott, A. Abramov, A. Sekar, D. Serbzhinskiy, D. Lorimer, G. W. Buchko, R. Stacy, L. J. Stewart, T. E. Edwards, W. C. Van Voorhis, P. J. Myler
Increasing The Structural Coverage Of Tuberculosis Drug Targets.
Tuberculosis (Edinb) V. 95 142 2015
PubMed-ID: 25613812 | Reference-DOI: 10.1016/J.TUBE.2014.12.003

Molecule 1 - ACETATE KINASE
	Chains	:	A, B
	EC Number	:	2.7.2.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PAVA0421
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	ACKA, MMAR_0711
	Organism Scientific	:	MYCOBACTERIUM MARINUM
	Organism Taxid	:	216594
	Strain	:	ATCC BAA-535 / M
	Synonym	:	ACETOKINASE

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 4DQ8)

(no "Site" information available for 4DQ8)

(no "SS Bond" information available for 4DQ8)

(no "Cis Peptide Bond" information available for 4DQ8)

(no "SAP(SNP)/Variant" information available for 4DQ8)

Asymmetric/Biological Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ACETATE_KINASE_1	PS01075	Acetate and butyrate kinases family signature 1.	ACKA_MYCMM	10-21	2	A:10-21 B:10-21
2	ACETATE_KINASE_2	PS01076	Acetate and butyrate kinases family signature 2.	ACKA_MYCMM	193-210	2	A:193-210 B:193-210

(no "Exon" information available for 4DQ8)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:373
 aligned with ACKA_MYCMM | B2HPZ3 from UniProtKB/Swiss-Prot  Length:388

    Alignment length:380
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386
           ACKA_MYCMM     7 NRVVLVLNSGSSSLKFQLVEPDSGMSRATGNIERIGEESSSVPDHDAALRRVFEILAEDDIDLQSCGLVAVGHRVVHGGKDFYEPTLLNDAVIGKLDELSPLAPLHNPPAVLCIRVARALLPDVPHIAVFDTAFFHQLPPAAATYAIDRELADVWKIRRYGFHGTSHEYVSQQAAEFLGKPIGDLNQIVLHLGNGASASAVAGGRPVETSMGLTPLEGLVMGTRSGDLDPGVIGYLWRTAKLGVDEIESMLNHRSGMLGLAGERDFRRLRAMIDDGDPAAELAYDVFIHRLRKYVGAYLAVLGHTDVVSFTAGIGEHDAAVRRDTLAGMAELGISLDERRNACPSGGARRISADDSPVTVLVIPTNEELAIARHCCSVLV 386
               SCOP domains d4dq8a1 A:7-186 automated matches                                                                                                                                                   d4dq8a2 A:187-386 automated matches                                                                                                                                                                      SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee....eeeeee......eeeeeee...-------.hhhhhhhhhhhhhhhh..hhhhh.eeeeeeee..........ee.hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhh...hhhhhhhh.......hhhhhhhhhhhhhhhhh.hhhh.eeeeeee...eeeeeee..eeeee...................hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeehhhhhhhhhhhhhhhh.hhhhh...hhhhhhh.....ee........eeee...hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---ACETATE_KINA---------------------------------------------------------------------------------------------------------------------------------------------------------------------------ACETATE_KINASE_2  -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4dq8 A   7 NRVVLVLNSGSSSLKFQLVEPDSGMSRATGNIERI-------PDHDAALRRVFEILAEDDIDLQSCGLVAVGHRVVHGGKDFYEPTLLNDAVIGKLDELSPLAPLHNPPAVLCIRVARALLPDVPHIAVFDTAFFHQLPPAAATYAIDRELADVWKIRRYGFHGTSHEYVSQQAAEFLGKPIGDLNQIVLHLGNGASASAVAGGRPVETSMGLTPLEGLVMGTRSGDLDPGVIGYLWRTAKLGVDEIESMLNHRSGMLGLAGERDFRRLRAMIDDGDPAAELAYDVFIHRLRKYVGAYLAVLGHTDVVSFTAGIGEHDAAVRRDTLAGMAELGISLDERRNACPSGGARRISADDSPVTVLVIPTNEELAIARHCCSVLV 386
                                    16        26        36    |    -  |     56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386
                                                             41      49

Chain B from PDB  Type:PROTEIN  Length:371
 aligned with ACKA_MYCMM | B2HPZ3 from UniProtKB/Swiss-Prot  Length:388

    Alignment length:379
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376         
           ACKA_MYCMM     7 NRVVLVLNSGSSSLKFQLVEPDSGMSRATGNIERIGEESSSVPDHDAALRRVFEILAEDDIDLQSCGLVAVGHRVVHGGKDFYEPTLLNDAVIGKLDELSPLAPLHNPPAVLCIRVARALLPDVPHIAVFDTAFFHQLPPAAATYAIDRELADVWKIRRYGFHGTSHEYVSQQAAEFLGKPIGDLNQIVLHLGNGASASAVAGGRPVETSMGLTPLEGLVMGTRSGDLDPGVIGYLWRTAKLGVDEIESMLNHRSGMLGLAGERDFRRLRAMIDDGDPAAELAYDVFIHRLRKYVGAYLAVLGHTDVVSFTAGIGEHDAAVRRDTLAGMAELGISLDERRNACPSGGARRISADDSPVTVLVIPTNEELAIARHCCSVL 385
               SCOP domains d4dq8b1 B:7-186 automated matches                                                                                                                                                   d4dq8b2 B:187-385 automated matches                                                                                                                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee..eeeeeee......eeeeeee....---.....hhhhhhhhhhhhhh...-----.eeeeeeee..........ee.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.....eeeee.hhhhh..hhhhhh...hhhhhhhh.......hhhhhhhhhhhhhhhhh.hhhh.eeeeeee...eeeeeee..eeeee....................hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeehhhhhhhhhhhhhhhh.hhhhh...hhhhhh......ee........eeee...hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---ACETATE_KINA---------------------------------------------------------------------------------------------------------------------------------------------------------------------------ACETATE_KINASE_2  ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4dq8 B   7 NRVVLVLNSGSSSLKFQLVEPDSGMSRATGNIERIG---SSVPDHDAALRRVFEILAEDDI-----GLVAVGHRVVHGGKDFYEPTLLNDAVIGKLDELSPLAPLHNPPAVLCIRVARALLPDVPHIAVFDTAFFHQLPPAAATYAIDRELADVWKIRRYGFHGTSHEYVSQQAAEFLGKPIGDLNQIVLHLGNGASASAVAGGRPVETSMGLTPLEGLVMGTRSGDLDPGVIGYLWRTAKLGVDEIESMLNHRSGMLGLAGERDFRRLRAMIDDGDPAAELAYDVFIHRLRKYVGAYLAVLGHTDVVSFTAGIGEHDAAVRRDTLAGMAELGISLDERRNACPSGGARRISADDSPVTVLVIPTNEELAIARHCCSVL 385
                                    16        26        36     |  46        56        66|     | 76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376         
                                                              42  46                   67    73

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Ribonuclease H-like motif (1424)

Superfamily: Actin-like ATPase domain (426)

Family: automated matches (111)

Protein domain: automated matches (111)

Mycobacterium marinum [TaxId: 216594] (1)

1a	d4dq8a1	A:7-186
1b	d4dq8a2	A:187-386
1c	d4dq8b1	B:7-186
1d	d4dq8b2	B:187-385

(no "CATH Domain" information available for 4DQ8)

(no "Pfam Domain" information available for 4DQ8)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (ACKA_MYCMM | B2HPZ3)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0008776	acetate kinase activity	Catalysis of the reaction: ATP + acetate = ADP + acetyl phosphate.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016774	phosphotransferase activity, carboxyl group as acceptor	Catalysis of the transfer of a phosphorus-containing group from one compound (donor) to a carboxyl group (acceptor).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006085	acetyl-CoA biosynthetic process	The chemical reactions and pathways resulting in the formation of acetyl-CoA, a derivative of coenzyme A in which the sulfhydryl group is acetylated.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0006082	organic acid metabolic process	The chemical reactions and pathways involving organic acids, any acidic compound containing carbon in covalent linkage.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4dq8)

	Sites
(no "Sites" information available for 4dq8)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4dq8)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4dq8
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ACKA_MYCMM \| B2HPZ3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.2.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ACKA_MYCMM \| B2HPZ3
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 4DQ8)

(no "Related Entries Specified in the PDB File" available for 4DQ8)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (14, 14)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File