4BUR - JenaLib

Asymmetric Unit (14, 56)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_072791	V	243	L	AIFM1_HUMAN	Disease	---	A/B/C/D	V	243	L
02	UniProt	VAR_076211	T	260	A	AIFM1_HUMAN	Disease (DFNX5)	863225432	A/B/C/D	T	260	A
03	UniProt	VAR_067334	G	308	E	AIFM1_HUMAN	Disease (COXPD6)	---	A/B/C/D	G	308	E
04	UniProt	VAR_076212	L	344	F	AIFM1_HUMAN	Unclassified (DFNX5)	184474885	A/B/C/D	L	344	F
05	UniProt	VAR_076213	G	360	R	AIFM1_HUMAN	Unclassified (DFNX5)	724160026	A/B/C/D	G	360	R
06	UniProt	VAR_076214	R	422	Q	AIFM1_HUMAN	Disease (DFNX5)	724160021	A/B/C/D	R	422	Q
07	UniProt	VAR_076215	R	422	W	AIFM1_HUMAN	Disease (DFNX5)	724160020	A/B/C/D	R	422	W
08	UniProt	VAR_076216	R	430	C	AIFM1_HUMAN	Unclassified (DFNX5)	---	A/B/C/D	R	430	C
09	UniProt	VAR_076217	R	451	Q	AIFM1_HUMAN	Disease (DFNX5)	863225431	A/B/C/D	R	451	Q
10	UniProt	VAR_076218	A	472	V	AIFM1_HUMAN	Unclassified (DFNX5)	---	A/B/C/D	A	472	V
11	UniProt	VAR_076219	P	475	L	AIFM1_HUMAN	Unclassified (DFNX5)	724160022	A/B/C/D	P	475	L
12	UniProt	VAR_069468	E	493	V	AIFM1_HUMAN	Disease (COWCK)	281864468	A/B/C/D	E	493	V
13	UniProt	VAR_076220	V	498	M	AIFM1_HUMAN	Unclassified (DFNX5)	724160023	A/B/C/D	V	498	M
14	UniProt	VAR_076221	I	591	M	AIFM1_HUMAN	Unclassified (DFNX5)	---	A/B/C/D	I	591	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (14, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_072791	V	243	L	AIFM1_HUMAN	Disease	---	A	V	243	L
02	UniProt	VAR_076211	T	260	A	AIFM1_HUMAN	Disease (DFNX5)	863225432	A	T	260	A
03	UniProt	VAR_067334	G	308	E	AIFM1_HUMAN	Disease (COXPD6)	---	A	G	308	E
04	UniProt	VAR_076212	L	344	F	AIFM1_HUMAN	Unclassified (DFNX5)	184474885	A	L	344	F
05	UniProt	VAR_076213	G	360	R	AIFM1_HUMAN	Unclassified (DFNX5)	724160026	A	G	360	R
06	UniProt	VAR_076214	R	422	Q	AIFM1_HUMAN	Disease (DFNX5)	724160021	A	R	422	Q
07	UniProt	VAR_076215	R	422	W	AIFM1_HUMAN	Disease (DFNX5)	724160020	A	R	422	W
08	UniProt	VAR_076216	R	430	C	AIFM1_HUMAN	Unclassified (DFNX5)	---	A	R	430	C
09	UniProt	VAR_076217	R	451	Q	AIFM1_HUMAN	Disease (DFNX5)	863225431	A	R	451	Q
10	UniProt	VAR_076218	A	472	V	AIFM1_HUMAN	Unclassified (DFNX5)	---	A	A	472	V
11	UniProt	VAR_076219	P	475	L	AIFM1_HUMAN	Unclassified (DFNX5)	724160022	A	P	475	L
12	UniProt	VAR_069468	E	493	V	AIFM1_HUMAN	Disease (COWCK)	281864468	A	E	493	V
13	UniProt	VAR_076220	V	498	M	AIFM1_HUMAN	Unclassified (DFNX5)	724160023	A	V	498	M
14	UniProt	VAR_076221	I	591	M	AIFM1_HUMAN	Unclassified (DFNX5)	---	A	I	591	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (14, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_072791	V	243	L	AIFM1_HUMAN	Disease	---	B	V	243	L
02	UniProt	VAR_076211	T	260	A	AIFM1_HUMAN	Disease (DFNX5)	863225432	B	T	260	A
03	UniProt	VAR_067334	G	308	E	AIFM1_HUMAN	Disease (COXPD6)	---	B	G	308	E
04	UniProt	VAR_076212	L	344	F	AIFM1_HUMAN	Unclassified (DFNX5)	184474885	B	L	344	F
05	UniProt	VAR_076213	G	360	R	AIFM1_HUMAN	Unclassified (DFNX5)	724160026	B	G	360	R
06	UniProt	VAR_076214	R	422	Q	AIFM1_HUMAN	Disease (DFNX5)	724160021	B	R	422	Q
07	UniProt	VAR_076215	R	422	W	AIFM1_HUMAN	Disease (DFNX5)	724160020	B	R	422	W
08	UniProt	VAR_076216	R	430	C	AIFM1_HUMAN	Unclassified (DFNX5)	---	B	R	430	C
09	UniProt	VAR_076217	R	451	Q	AIFM1_HUMAN	Disease (DFNX5)	863225431	B	R	451	Q
10	UniProt	VAR_076218	A	472	V	AIFM1_HUMAN	Unclassified (DFNX5)	---	B	A	472	V
11	UniProt	VAR_076219	P	475	L	AIFM1_HUMAN	Unclassified (DFNX5)	724160022	B	P	475	L
12	UniProt	VAR_069468	E	493	V	AIFM1_HUMAN	Disease (COWCK)	281864468	B	E	493	V
13	UniProt	VAR_076220	V	498	M	AIFM1_HUMAN	Unclassified (DFNX5)	724160023	B	V	498	M
14	UniProt	VAR_076221	I	591	M	AIFM1_HUMAN	Unclassified (DFNX5)	---	B	I	591	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (14, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_072791	V	243	L	AIFM1_HUMAN	Disease	---	C	V	243	L
02	UniProt	VAR_076211	T	260	A	AIFM1_HUMAN	Disease (DFNX5)	863225432	C	T	260	A
03	UniProt	VAR_067334	G	308	E	AIFM1_HUMAN	Disease (COXPD6)	---	C	G	308	E
04	UniProt	VAR_076212	L	344	F	AIFM1_HUMAN	Unclassified (DFNX5)	184474885	C	L	344	F
05	UniProt	VAR_076213	G	360	R	AIFM1_HUMAN	Unclassified (DFNX5)	724160026	C	G	360	R
06	UniProt	VAR_076214	R	422	Q	AIFM1_HUMAN	Disease (DFNX5)	724160021	C	R	422	Q
07	UniProt	VAR_076215	R	422	W	AIFM1_HUMAN	Disease (DFNX5)	724160020	C	R	422	W
08	UniProt	VAR_076216	R	430	C	AIFM1_HUMAN	Unclassified (DFNX5)	---	C	R	430	C
09	UniProt	VAR_076217	R	451	Q	AIFM1_HUMAN	Disease (DFNX5)	863225431	C	R	451	Q
10	UniProt	VAR_076218	A	472	V	AIFM1_HUMAN	Unclassified (DFNX5)	---	C	A	472	V
11	UniProt	VAR_076219	P	475	L	AIFM1_HUMAN	Unclassified (DFNX5)	724160022	C	P	475	L
12	UniProt	VAR_069468	E	493	V	AIFM1_HUMAN	Disease (COWCK)	281864468	C	E	493	V
13	UniProt	VAR_076220	V	498	M	AIFM1_HUMAN	Unclassified (DFNX5)	724160023	C	V	498	M
14	UniProt	VAR_076221	I	591	M	AIFM1_HUMAN	Unclassified (DFNX5)	---	C	I	591	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (14, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_072791	V	243	L	AIFM1_HUMAN	Disease	---	D	V	243	L
02	UniProt	VAR_076211	T	260	A	AIFM1_HUMAN	Disease (DFNX5)	863225432	D	T	260	A
03	UniProt	VAR_067334	G	308	E	AIFM1_HUMAN	Disease (COXPD6)	---	D	G	308	E
04	UniProt	VAR_076212	L	344	F	AIFM1_HUMAN	Unclassified (DFNX5)	184474885	D	L	344	F
05	UniProt	VAR_076213	G	360	R	AIFM1_HUMAN	Unclassified (DFNX5)	724160026	D	G	360	R
06	UniProt	VAR_076214	R	422	Q	AIFM1_HUMAN	Disease (DFNX5)	724160021	D	R	422	Q
07	UniProt	VAR_076215	R	422	W	AIFM1_HUMAN	Disease (DFNX5)	724160020	D	R	422	W
08	UniProt	VAR_076216	R	430	C	AIFM1_HUMAN	Unclassified (DFNX5)	---	D	R	430	C
09	UniProt	VAR_076217	R	451	Q	AIFM1_HUMAN	Disease (DFNX5)	863225431	D	R	451	Q
10	UniProt	VAR_076218	A	472	V	AIFM1_HUMAN	Unclassified (DFNX5)	---	D	A	472	V
11	UniProt	VAR_076219	P	475	L	AIFM1_HUMAN	Unclassified (DFNX5)	724160022	D	P	475	L
12	UniProt	VAR_069468	E	493	V	AIFM1_HUMAN	Disease (COWCK)	281864468	D	E	493	V
13	UniProt	VAR_076220	V	498	M	AIFM1_HUMAN	Unclassified (DFNX5)	724160023	D	V	498	M
14	UniProt	VAR_076221	I	591	M	AIFM1_HUMAN	Unclassified (DFNX5)	---	D	I	591	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (13, 52)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:450
 aligned with AIFM1_HUMAN | O95831 from UniProtKB/Swiss-Prot  Length:613

    Alignment length:484
                                   137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607    
          AIFM1_HUMAN   128 APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH 611
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee..hhhhhhhhhhhhhhh...eeeeee........hhhhhhhhhh....hhhhhheee.....eee....hhhhh............eeeeee...eeeee....eeee....eeeeeeeee...eee..hhhhhh.hhhhhh.ee...hhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhhhhhh.eeeee...........hhhhhhhhhhhhhh...eee....eeeeeee..eeeeee....eeee.eeee...eee...hhhhhh.........ee.....eee..eee....eeeee...eeee..hhhhhhhhhhhhhhhhh..........eeeeee...eeeeeee.......eeeee.....ee.----------------------------------............eeeeeee..eeeeeeee....hhhhhhhhhhhh....hhhhhhhh.... Sec.struct. author
             SAPs(SNPs) (1) -------------------------------------------------------------------------------------------------------------------L----------------A-----------------------------------------------E-----------------------------------F---------------R-------------------------------------------------------------Q-------C--------------------Q--------------------V--L-----------------V----M--------------------------------------------------------------------------------------------M-------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------W--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5b  PDB: A:128-158      Exon 1.6b  PDB: A:159-202 UniProt: 159-202  ------------------------------Exon 1.8  PDB: A:233-261     -------------------------Exon 1.10  PDB: A:287-323            -----------------------------------Exon 1.12b  PDB: A:359-388    Exon 1.13  PDB: A:389-435 UniProt: 389-435     Exon 1.14  PDB: A:436-483 UniProt: 436-483      -----------------------------------------Exon 1.16  PDB: A:551-590 UniProt: 525-590 [INCOMPLETE]           Exon 1.17a            Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------Exon 1.7  PDB: A:202-232       ----------------------------Exon 1.9  PDB: A:261-286  ------------------------------------Exon 1.11c  PDB: A:323-359           ---------------------------------------------------------------------------------------------------------------------------Exon 1.15  PDB: A:483-516 UniProt: 483-525 -------------------------------------------------------------------------------------- Transcript 1 (2)
                 4bur A 128 APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDN----------------------------------PQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH 611
                                   137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507        |-         -         -         -   |   557       567       577       587       597       607    
                                                                                                                                                                                                                                                                                                                                                                                                                              516                                551

Chain B from PDB  Type:PROTEIN  Length:450
 aligned with AIFM1_HUMAN | O95831 from UniProtKB/Swiss-Prot  Length:613

    Alignment length:486
                                   134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604      
          AIFM1_HUMAN   125 QDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI 610
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeeeeee..hhhhhhhhhhhhhh....eeeeee........hhhhh.........hhhhhheee.....eee.....................eeeeee...eeeee....eeee....eeeeeeeee...eee..hhhhhh.hhhhhh.ee...hhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhhhhhh.eeeee...........hhhhhhhhhhhhhhh..eee....eeeeeee..eeeeee....eeee.eeee...eee..hhhhhhh.........ee.....eee..eee....eeeee...eeee..hhhhhhhhhhhhhhhhh..........eeeee.....eeeeee.......eeeee.....ee.------------------------------------..........eeeeeee..eeeeeeee....hhhhhhhhhhhh....hhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) ----------------------------------------------------------------------------------------------------------------------L----------------A-----------------------------------------------E-----------------------------------F---------------R-------------------------------------------------------------Q-------C--------------------Q--------------------V--L-----------------V----M--------------------------------------------------------------------------------------------M------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------W-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.5b  PDB: B:125-158         Exon 1.6b  PDB: B:159-202 UniProt: 159-202  ------------------------------Exon 1.8  PDB: B:233-261     -------------------------Exon 1.10  PDB: B:287-323            -----------------------------------Exon 1.12b  PDB: B:359-388    Exon 1.13  PDB: B:389-435 UniProt: 389-435     Exon 1.14  PDB: B:436-483 UniProt: 436-483      -----------------------------------------Exon 1.16  PDB: B:553-590 UniProt: 525-590 [INCOMPLETE]           Exon 1.17a           Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------Exon 1.7  PDB: B:202-232       ----------------------------Exon 1.9  PDB: B:261-286  ------------------------------------Exon 1.11c  PDB: B:323-359           ---------------------------------------------------------------------------------------------------------------------------Exon 1.15  PDB: B:483-516 UniProt: 483-525 ------------------------------------------------------------------------------------- Transcript 1 (2)
                 4bur B 125 QDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDN------------------------------------APVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI 610
                                   134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514 |       -         -         -       554       564       574       584       594       604      
                                                                                                                                                                                                                                                                                                                                                                                                                                 516                                  553

Chain C from PDB  Type:PROTEIN  Length:446
 aligned with AIFM1_HUMAN | O95831 from UniProtKB/Swiss-Prot  Length:613

    Alignment length:486
                                   136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606      
          AIFM1_HUMAN   127 KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE 612
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeee..hhhhhhhhhhhhhhh...eeeeee........hhhhhh........hhhhhheee.....eee....hhhhh............eeeeee...eeeeehhh.eeee....eeeeeeeee...eee..hhhhhh.hhhhhh.eee..hhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhhhhh..eeeee...........hhhhhhhhhhhhhh...eee....eeeeeee..eeeeee....eeee.eeee...eee...hhhhhh.........eee....eee..eee....eeeee...eeee..hhhhhhhhhhhhhhhhh..........eeeee.....eeeeee.......eeeee.....eee.----------------------------------------.....eeeeeee..eeeeeeee....hhhhhhhhhhhh....hhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------------------------------------------------------------------------------L----------------A-----------------------------------------------E-----------------------------------F---------------R-------------------------------------------------------------Q-------C--------------------Q--------------------V--L-----------------V----M--------------------------------------------------------------------------------------------M--------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------W---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.5b  PDB: C:127-158       Exon 1.6b  PDB: C:159-202 UniProt: 159-202  ------------------------------Exon 1.8  PDB: C:233-261     -------------------------Exon 1.10  PDB: C:287-323            -----------------------------------Exon 1.12b  PDB: C:359-388    Exon 1.13  PDB: C:389-435 UniProt: 389-435     Exon 1.14  PDB: C:436-483 UniProt: 436-483      -----------------------------------------Exon 1.16  PDB: C:558-590 UniProt: 525-590 [INCOMPLETE]           Exon 1.17a             Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------Exon 1.7  PDB: C:202-232       ----------------------------Exon 1.9  PDB: C:261-286  ------------------------------------Exon 1.11c  PDB: C:323-359           ---------------------------------------------------------------------------------------------------------------------------Exon 1.15  PDB: C:483-517 UniProt: 483-525 --------------------------------------------------------------------------------------- Transcript 1 (2)
                 4bur C 127 KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNP----------------------------------------EDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE 612
                                   136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516|        -         -         -         - |     566       576       586       596       606      
                                                                                                                                                                                                                                                                                                                                                                                                                                517                                      558

Chain D from PDB  Type:PROTEIN  Length:435
 aligned with AIFM1_HUMAN | O95831 from UniProtKB/Swiss-Prot  Length:613

    Alignment length:484
                                   137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607    
          AIFM1_HUMAN   128 APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH 611
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee..hhhhhhhhhhhhhhh...eeeeee........hhhhhh........hhhhhheee.....eee....hhhhh............eeeeee...eeeee....eeee....eeeeeeeee...eee..hhhhhhh...hhh.ee...hhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhhhh..eeeee...........hhhhhhhhhhhhhh...eee....eeeeeee..eeeeee....eeee.eeee...eee...hhhhhh.........ee.....eee..eee....eeeee...eeee..hhhhhhhhhhhhhhhhh..........eeeeee...eeeeeee.......eeeee.-------------------------------------------------....eeeeeee..eeeeeeee....hhhhhhhhhhhh....hhhhhh...... Sec.struct. author
             SAPs(SNPs) (1) -------------------------------------------------------------------------------------------------------------------L----------------A-----------------------------------------------E-----------------------------------F---------------R-------------------------------------------------------------Q-------C--------------------Q--------------------V--L-----------------V----M--------------------------------------------------------------------------------------------M-------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------W--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5b  PDB: D:128-158      Exon 1.6b  PDB: D:159-202 UniProt: 159-202  ------------------------------Exon 1.8  PDB: D:233-261     -------------------------Exon 1.10  PDB: D:287-323            -----------------------------------Exon 1.12b  PDB: D:359-388    Exon 1.13  PDB: D:389-435 UniProt: 389-435     Exon 1.14  PDB: D:436-483 UniProt: 436-483      -----------------------------------------Exon 1.16  PDB: D:559-590 UniProt: 525-590 [INCOMPLETE]           Exon 1.17a            Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------Exon 1.7  PDB: D:202-232       ----------------------------Exon 1.9  PDB: D:261-286  ------------------------------------Exon 1.11c  PDB: D:323-359           ---------------------------------------------------------------------------------------------------------------------------Exon 1.15  PDB: D:483-509 UniProt: 483-525 -------------------------------------------------------------------------------------- Transcript 1 (2)
                 4bur D 128 APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFA-------------------------------------------------DYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH 611
                                   137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507 |       -         -         -         -         - |     567       577       587       597       607    
                                                                                                                                                                                                                                                                                                                                                                                                                       509                                               559

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (39, 39)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (AIFM1_HUMAN | O95831)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0071949	FAD binding	Interacting selectively and non-covalently with the oxidized form, FAD, of flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
	GO:0016174	NAD(P)H oxidase activity	Catalysis of the reaction: NAD(P)H + H+ + O2 = NAD(P)+ + hydrogen peroxide.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0050660	flavin adenine dinucleotide binding	Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016651	oxidoreductase activity, acting on NAD(P)H	Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046983	protein dimerization activity	The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
biological process
	GO:0006308	DNA catabolic process	The cellular DNA metabolic process resulting in the breakdown of DNA, deoxyribonucleic acid, one of the two main types of nucleic acid, consisting of a long unbranched macromolecule formed from one or two strands of linked deoxyribonucleotides, the 3'-phosphate group of each constituent deoxyribonucleotide being joined in 3',5'-phosphodiester linkage to the 5'-hydroxyl group of the deoxyribose moiety of the next one.
	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:1904045	cellular response to aldosterone	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an aldosterone stimulus.
	GO:0071392	cellular response to estradiol stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
	GO:0070301	cellular response to hydrogen peroxide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hydrogen peroxide (H2O2) stimulus.
	GO:0071732	cellular response to nitric oxide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nitric oxide stimulus.
	GO:0090650	cellular response to oxygen-glucose deprivation	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of the deprivation of oxygen and glucose.
	GO:0030261	chromosome condensation	The progressive compaction of dispersed interphase chromatin into threadlike chromosomes prior to mitotic or meiotic nuclear division, or during apoptosis, in eukaryotic cells.
	GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced in response to a stimulus indicating endoplasmic reticulum (ER) stress, and ends when the execution phase of apoptosis is triggered. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
	GO:0032981	mitochondrial respiratory chain complex I assembly	The aggregation, arrangement and bonding together of a set of components to form mitochondrial respiratory chain complex I.
	GO:0051402	neuron apoptotic process	Any apoptotic process in a neuron, the basic cellular unit of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the nervous system.
	GO:0030182	neuron differentiation	The process in which a relatively unspecialized cell acquires specialized features of a neuron.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0010942	positive regulation of cell death	Any process that increases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
	GO:0043525	positive regulation of neuron apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death of neurons by apoptotic process.
	GO:1902510	regulation of apoptotic DNA fragmentation	Any process that modulates the frequency, rate or extent of apoptotic DNA fragmentation.
	GO:1902065	response to L-glutamate	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an L-glutamate stimulus.
	GO:0002931	response to ischemia	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a inadequate blood supply.
	GO:0009636	response to toxic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a toxic stimulus.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005758	mitochondrial intermembrane space	The region between the inner and outer lipid bilayers of the mitochondrial envelope.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 13)

Sites (13, 13)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (14, 56)

PROSITE Motifs (0, 0)

Exons (13, 52)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (39, 39)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File