Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MOSS LEAFY BOUND TO DNA
 
Authors :  M. H. Nanao, C. Sayou, R. Dumas, F. Parcy
Date :  03 Apr 13  (Deposition) - 22 Jan 14  (Release) - 19 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.32
Chains :  Asym./Biol. Unit :  A,B,W,X
Keywords :  Transcription-Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Sayou, M. Monniaux, M. H. Nanao, E. Moyroud, S. F. Brockington, E. Thevenon, H. Chahtane, N. Warthmann, M. Melkonian, Y. Zhang, G. K. Wong, D. Weigel, F. Parcy, R. Dumas
A Promiscuous Intermediate Underlies The Evolution Of Leafy Dna Binding Specificity.
Science V. 343 645 2014
PubMed-ID: 24436181  |  Reference-DOI: 10.1126/SCIENCE.1248229

(-) Compounds

Molecule 1 - FLORICAULA/LEAFY HOMOLOG 1
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PPLFY-CTER
    Expression System Taxid: 562
    Expression System Vector: PETM-11
    Expression System Vector Type: PLASMID
    Fragment: DNA-BINDING DOMAIN, RESIDUES 180-347
    Organism Scientific: PHYSCOMITRELLA PATENS
    Organism Taxid: 3218
 
Molecule 2 - MOSS-CR54 DNA
    Chains: W
    Organism Scientific: PHYSCOMITRELLA PATENS
    Organism Taxid: 3218
    Synthetic: YES
 
Molecule 3 - MOSS-CR54 DNA
    Chains: X
    Organism Scientific: PHYSCOMITRELLA PATENS
    Organism Taxid: 3218
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABWX

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4BHK)

(-) Sites  (0, 0)

(no "Site" information available for 4BHK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4BHK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4BHK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4BHK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4BHK)

(-) Exons   (0, 0)

(no "Exon" information available for 4BHK)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:158
 aligned with Q94IF5_PHYPA | Q94IF5 from UniProtKB/TrEMBL  Length:348

    Alignment length:158
                                   198       208       218       228       238       248       258       268       278       288       298       308       318       328       338        
         Q94IF5_PHYPA   189 PREHPFIVTEPGEPAKGKKNGLDYLFDLYEQCGKFLEEVQHIAKEKGEKCPSKVTNEVFRHAKLTGAGYINKPKMRDYVHCYALHCLDVETSNNLRKEYKERGENVGAWCQACYFPLVKLARQNEWDIDDLFNRNDKLRIWYVPTKLRQLCHIERMKH 346
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....................hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhh........hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4bhk A 189 PREHPFIVTEPGEPAKGKKNGLDYLFDLYEQCGKFLEEVQHIAKEKGEKCPSKVTNEVFRHAKLTGAGYINKPKMRDYVHCYALHCLDVETSNNLRKEYKERGENVGAWCQACYFPLVKLARQNEWDIDDLFNRNDKLRIWYVPTKLRQLCHIERMKH 346
                                   198       208       218       228       238       248       258       268       278       288       298       308       318       328       338        


Chain B from PDB  Type:PROTEIN  Length:158
 aligned with Q94IF5_PHYPA | Q94IF5 from UniProtKB/TrEMBL  Length:348

    Alignment length:158
                                   198       208       218       228       238       248       258       268       278       288       298       308       318       328       338        
         Q94IF5_PHYPA   189 PREHPFIVTEPGEPAKGKKNGLDYLFDLYEQCGKFLEEVQHIAKEKGEKCPSKVTNEVFRHAKLTGAGYINKPKMRDYVHCYALHCLDVETSNNLRKEYKERGENVGAWCQACYFPLVKLARQNEWDIDDLFNRNDKLRIWYVPTKLRQLCHIERMKH 346
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....................hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhh........hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4bhk B 189 PREHPFIVTEPGEPAKGKKNGLDYLFDLYEQCGKFLEEVQHIAKEKGEKCPSKVTNEVFRHAKLTGAGYINKPKMRDYVHCYALHCLDVETSNNLRKEYKERGENVGAWCQACYFPLVKLARQNEWDIDDLFNRNDKLRIWYVPTKLRQLCHIERMKH 346
                                   198       208       218       228       238       248       258       268       278       288       298       308       318       328       338        


Chain W from PDB  Type:DNA  Length:29
                                                             
                 4bhk W   1 GCCACGGGCGACCAGCGGACGGTGAGCAC  29
                                    10        20         


Chain X from PDB  Type:DNA  Length:29
                                                             
                 4bhk X   1 GTGCTCACCGTCCGCTGGTCGCCCGTGGC  29
                                    10        20
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4BHK)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4BHK)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4BHK)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q94IF5_PHYPA | Q94IF5)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4bhk)
 
  Sites
(no "Sites" information available for 4bhk)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4bhk)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4bhk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q94IF5_PHYPA | Q94IF5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q94IF5_PHYPA | Q94IF5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4BHK)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4BHK)